KEGG   Staphylococcus epidermidis RP62A: SEA0004Help
Entry
SEA0004           CDS       T00229                                 

Gene name
blaR1-2
Definition
regulatory protein BlaR1
Orthology
K02172  
bla regulator protein blaR1
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
beta-Lactam resistance
Module
beta-Lactam resistance, Bla system
Class
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:ser00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSERP:2651..4408
Genome map
AA seq 585 aa AA seqDB search
MAKLLIMSVVSFCFIFLLLVFFRYILKRYFNYSLNYKVWYLTVLAGLIPFIPIKFSFIKF
NNVNNQSPTVESRSHDLNHNINTTKPVQEFTTDIHKFNWDSIDNICTVIWIVLVIILSFK
FLKSLLYLKYLKRQSLYLNENEKNKIDTILFNHQYKKNIVIRKAETIQSPITFWYGKYII
LIPSSYFKSVIDKRLKYIILHEYAHAKNRDTLHLIIFNIFSIVMSYNPLIHIVKRKIIHD
NEVEADRFVLNNINKNEFKTYAESIMDSVLNIPFFNKNILSHSFNGKKSLLKRRLINIKE
ANLKKQSKLIPIFICIFTFLLMVIQSQFLMGQSITDYNYKKPLQNDHQILDESKNFGSNS
GSFVMYSMKKDKYYIYNEKESRKRYSPDSTYKIYLAMFGLDHHIISDKNSRMSWNHKHYP
FESWNKEQDLNTAMQNSVNWYFERISNQIPKNYTAAQLKQLNYGNENLGSYKSYWMEDSL
KISNLEQVIVFKNMMEQNNHFSKKAKNQLSSSLLIKKNEKYELYGKTGTGIVNGKYNNGW
FVGYVITNHDKYYFATHLSDGKPSGKNAELISEKILKEMGVLNGQ
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattactaataatgagcgtagtaagcttttgttttatatttctattgttagta
ttttttaggtatatattaaaacgctattttaattatagtttaaattataaagtttggtat
ctaactgtgcttgctggattaattccttttatcccaattaaattctcttttataaaattt
aataatgtgaataatcaatcgcccacagttgaaagtaggtcacacgacttgaaccataac
ataaataccaccaaacctgttcaagagttcacaacagatatccataagtttaattgggat
tcaattgataatatctgcacagttatttggatagttttggttattattttaagttttaaa
tttttgaaatccttattatatcttaaatatttaaagagacagtcactttatctaaacgaa
aatgaaaaaaataaaatagatacgatacttttcaaccatcaatataaaaaaaatattgtg
attcgaaaagcagagactattcaatctccaataactttttggtatgggaaatatattatt
ttgattcctagttcatattttaaaagtgtaattgacaaaagactaaaatatataatattg
catgaatatgctcatgctaaaaatagagatactttacatttaattatctttaatatcttc
tctattgttatgagttacaatccattaatacatattgtaaaaagaaagataattcatgac
aatgaagtagaagccgatagatttgttcttaataatattaacaaaaatgaatttaaaact
tatgcggaatctattatggactccgtattaaatattccattttttaataaaaatatatta
agccattcatttaatggtaaaaagtcattactcaaaagaagattaattaatataaaagaa
gccaatttgaaaaaacagtccaaattaattccaatttttatttgtatttttacttttttg
ctcatggtaattcaaagccagtttttgatggggcaatccataactgattataattataaa
aagcccttacagaacgatcaccaaattttagatgaaagtaaaaattttggttcaaatagt
ggatctttcgtcatgtacagcatgaagaaagacaaatactatatttataatgaaaaagaa
agtagaaagagatattctcctgattcaacttataaaatttatttagcgatgtttggactt
gaccatcatatcataagtgataaaaattcacgtatgtcatggaatcataaacattatcct
ttcgagtcttggaataaggaacaagatttaaatacagcaatgcaaaattcagttaattgg
tacttcgaacgtattagtaatcaaataccaaagaactatactgcggctcaactcaagcaa
ttaaattatggtaatgaaaacttgggaagttataaaagctattggatggaagatagtttg
aaaatatctaatcttgaacaagtaatagtttttaaaaatatgatggaacaaaataaccat
tttagtaaaaaagcaaagaatcaattatcttcttcattattgattaagaaaaatgaaaag
tatgaactgtatgggaaaacaggtacaggtatagtaaacgggaagtataataatgggtgg
tttgtaggttacgtaattacaaatcatgataagtattattttgctacacatttatcagat
ggaaagccgtctgggaaaaatgctgaattaatcagtgaaaaaatattaaaagaaatgggt
gttttaaatggccaataa

DBGET integrated database retrieval system