KEGG   Staphylococcus epidermidis RP62A: SEA0005Help
Entry
SEA0005           CDS       T00229                                 

Gene name
blaI-2
Definition
penicillinase repressor
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSERP:4425..4778
Genome map
AA seq 117 aa AA seqDB search
MAEWDVMNIIWDKKSVSANEIVVEIQKYKEVSDKTIRTLITRLYKKEIIKRYKSENIYFY
SSNIKEDDIKMKTAKTFLNKLYGGDMKSLVLNFAKNEELNNKEIEELRDILNDISKK
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggctgaatgggatgttatgaatataatatgggataaaaaatcagtatcagctaatgaa
attgtagttgaaattcaaaaatataaagaagttagcgataaaacgattagaacattaatc
acaagactatataaaaaagagattataaaacgatacaaatcagagaatatttatttttac
tcatcaaatattaaagaagacgatattaaaatgaaaactgctaaaacctttcttaataaa
ctgtatggaggggacatgaaaagtttagtgctgaattttgcgaaaaatgaagaattaaat
aacaaagaaattgaagaattgcgagacattttaaatgatattagtaaaaagtaa

DBGET integrated database retrieval system