KEGG   Staphylococcus epidermidis RP62A: SEA0008Help
Entry
SEA0008           CDS       T00229                                 

Definition
(GenBank) IS431mec-like transposase
  KO
K07498  putative transposase
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_Tnp_IS240 rve DDE_Tnp_IS66 DDE_3 HTH_32 HTH_23 HTH_28 HTH_Tnp_4 HEM4 DUF1580 Melibiase_2_C
Motif
Other DBs
NCBI-ProteinID: AAW52782
UniProt: Q5HS61
Position
pSERP:6361..7035
Genome map
AA seq 224 aa AA seqDB search
MNYFRYKQFNKDVITVAVGYYLRYALSYRDISEILRERGVNVHHSTVYRWVQEYAPILYQ
IWKKKHKKAYYKWRIDETYIKIKGKWSYLYRAIDAEGHTLDIWLRKQRDNHSAYAFIKRL
IKQFGKPQKVITDQAPSTKVAMVKVIKAFKLKPDCHCTSKYLNNLIEQDHRHIKVRKTRY
QSINTAKNTLKGIECIYALYKKNRRSLQIYGFSPCHEISIMLAS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaactatttcagatataaacaatttaacaaggatgttatcactgtagctgttggctac
tatctaagatatgcattgagttatcgtgatatatctgaaatattaagggaacgtggtgta
aacgttcatcattcaacggtctaccgttgggttcaagaatatgccccaattttatatcaa
atttggaagaaaaagcataaaaaagcttattacaaatggcgtattgatgagacgtacatc
aaaataaaaggaaaatggagctatttatatcgtgccattgatgcagagggacatacatta
gatatttggttgcgtaagcaacgagataatcattcagcatatgcgtttatcaaacgtctc
attaaacaatttggtaaacctcaaaaggtaattacagatcaggcaccttcaacgaaggta
gcaatggttaaagtaattaaagcttttaaacttaaacctgactgccattgtacatcgaaa
tatctgaataacctcattgagcaagatcaccgtcatattaaagtaagaaagacaaggtat
caaagtatcaatacagcaaagaatactttaaaaggtattgagtgtatttacgctctatat
aaaaagaaccgcaggtctcttcagatctacggattttcgccatgccacgaaattagcatc
atgctagcaagttaa

DBGET integrated database retrieval system