KEGG   Staphylococcus epidermidis RP62A: SEA0008Help
Entry
SEA0008           CDS       T00229                                 

Definition
IS431mec-like transposase
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSERP:6361..7035
Genome map
AA seq 224 aa AA seqDB search
MNYFRYKQFNKDVITVAVGYYLRYALSYRDISEILRERGVNVHHSTVYRWVQEYAPILYQ
IWKKKHKKAYYKWRIDETYIKIKGKWSYLYRAIDAEGHTLDIWLRKQRDNHSAYAFIKRL
IKQFGKPQKVITDQAPSTKVAMVKVIKAFKLKPDCHCTSKYLNNLIEQDHRHIKVRKTRY
QSINTAKNTLKGIECIYALYKKNRRSLQIYGFSPCHEISIMLAS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaactatttcagatataaacaatttaacaaggatgttatcactgtagctgttggctac
tatctaagatatgcattgagttatcgtgatatatctgaaatattaagggaacgtggtgta
aacgttcatcattcaacggtctaccgttgggttcaagaatatgccccaattttatatcaa
atttggaagaaaaagcataaaaaagcttattacaaatggcgtattgatgagacgtacatc
aaaataaaaggaaaatggagctatttatatcgtgccattgatgcagagggacatacatta
gatatttggttgcgtaagcaacgagataatcattcagcatatgcgtttatcaaacgtctc
attaaacaatttggtaaacctcaaaaggtaattacagatcaggcaccttcaacgaaggta
gcaatggttaaagtaattaaagcttttaaacttaaacctgactgccattgtacatcgaaa
tatctgaataacctcattgagcaagatcaccgtcatattaaagtaagaaagacaaggtat
caaagtatcaatacagcaaagaatactttaaaaggtattgagtgtatttacgctctatat
aaaaagaaccgcaggtctcttcagatctacggattttcgccatgccacgaaattagcatc
atgctagcaagttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system