KEGG   Staphylococcus epidermidis RP62A: SEA0014Help
Entry
SEA0014           CDS       T00229                                 

Definition
UbiE/COQ5 family methlytransferase
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSERP:complement(10055..10789)
Genome map
AA seq 244 aa AA seqDB search
MKENKYDDNIFFQKYSQMSRSQKGLAGAGEWETLKKMLPDFKGKRVLDLGCGYGWHCIYA
MENGASSVVGVDISHKMLEVAKGKTHFPQIEYECCAIEDVDFPEESFDVILSSLAFHYVA
DYENLIKKIYRMLKAGGNLVFTVEHPVFTAHGTQDWYYNEKGEILHFPVDNYYYEGKRTA
MFLEEKVTKYHRTLTTYLNTLLSNSFIINQIVEPQPPENMMDIPGMADEMRRPMMLIVSA
KKKM
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaacaaatatgatgataatatattttttcaaaaatacagtcaaatgagtcgc
tcgcagaaaggactggctggtgcgggagaatgggagactttgaaaaagatgctacctgat
tttaagggtaagcgtgtgcttgatttaggatgcggctatggatggcactgtatatatgcg
atggaaaacggtgcttcctctgtagtaggtgttgatatttctcataaaatgctcgaagta
gcaaaaggaaaaacccattttccacagattgaatatgaatgctgtgccatagaagatgtg
gatttcccagaggagagctttgatgtaatactaagttcgcttgcgtttcattatgtagca
gactatgagaatttaataaaaaagatatataggatgctgaaggctggtggcaatttagtt
tttacagttgaacatcctgtttttactgctcatggaacacaagactggtattataacgaa
aaaggagaaatactgcatttcccggtggacaattattattatgagggcaaacggacagct
atgtttttggaagaaaaggttacaaaatatcatagaacactgaccacatatctaaataca
ctgctttcaaatagttttataataaatcagattgtggagccacagccgccagagaacatg
atggatattccggggatggcggatgaaatgcgacgcccaatgatgctgattgtatcggca
aaaaagaagatgtaa

DBGET integrated database retrieval system