KEGG   Staphylococcus epidermidis RP62A: SEA0014Help
Entry
SEA0014           CDS       T00229                                 

Definition
(GenBank) methyltransferase, UbiE/COQ5 family
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_23 Methyltransf_31 Ubie_methyltran Methyltransf_12 Methyltransf_9 MTS CMAS PrmA TehB NodS PCMT Methyltransf_8 DREV Methyltransf_4 Methyltransf_18 FtsJ Methyltransf_29 MetW TPMT NNMT_PNMT_TEMT
Motif
Other DBs
NCBI-ProteinID: AAW52788
UniProt: Q5HS55
Position
pSERP:complement(10055..10789)
Genome map
AA seq 244 aa AA seqDB search
MKENKYDDNIFFQKYSQMSRSQKGLAGAGEWETLKKMLPDFKGKRVLDLGCGYGWHCIYA
MENGASSVVGVDISHKMLEVAKGKTHFPQIEYECCAIEDVDFPEESFDVILSSLAFHYVA
DYENLIKKIYRMLKAGGNLVFTVEHPVFTAHGTQDWYYNEKGEILHFPVDNYYYEGKRTA
MFLEEKVTKYHRTLTTYLNTLLSNSFIINQIVEPQPPENMMDIPGMADEMRRPMMLIVSA
KKKM
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaacaaatatgatgataatatattttttcaaaaatacagtcaaatgagtcgc
tcgcagaaaggactggctggtgcgggagaatgggagactttgaaaaagatgctacctgat
tttaagggtaagcgtgtgcttgatttaggatgcggctatggatggcactgtatatatgcg
atggaaaacggtgcttcctctgtagtaggtgttgatatttctcataaaatgctcgaagta
gcaaaaggaaaaacccattttccacagattgaatatgaatgctgtgccatagaagatgtg
gatttcccagaggagagctttgatgtaatactaagttcgcttgcgtttcattatgtagca
gactatgagaatttaataaaaaagatatataggatgctgaaggctggtggcaatttagtt
tttacagttgaacatcctgtttttactgctcatggaacacaagactggtattataacgaa
aaaggagaaatactgcatttcccggtggacaattattattatgagggcaaacggacagct
atgtttttggaagaaaaggttacaaaatatcatagaacactgaccacatatctaaataca
ctgctttcaaatagttttataataaatcagattgtggagccacagccgccagagaacatg
atggatattccggggatggcggatgaaatgcgacgcccaatgatgctgattgtatcggca
aaaaagaagatgtaa

DBGET integrated database retrieval system