KEGG   Staphylococcus epidermidis RP62A: SEA0018Help
Entry
SEA0018           CDS       T00229                                 

Definition
(GenBank) ABC transporter, ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
ser  Staphylococcus epidermidis RP62A
Module
ser_M00254  ABC-2 type transport system
Brite
Transporters [BR:ser02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254] [OT]
    SEA0018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N RsgA_GTPase AAA_15 AAA_16 AAA_23 IstB_IS21 Roc AAA_29 AAA_5 AAA_33 AAA_30 AAA PhoH AAA_22 AAA_19 MobB NB-ARC TsaE MMR_HSR1 AAA_24 BCA_ABC_TP_C Mg_chelatase AAA_25 AAA_18 AAA_11 AAA_28
Motif
Other DBs
NCBI-ProteinID: AAW52792
UniProt: Q5HS51
Position
pSERP:complement(13801..14505)
Genome map
AA seq 234 aa AA seqDB search
MIEVKNVSKSFGKQQVVDDISISFNAGEVVGLIGPSGTGKTTLIQCILGMEKIDGGQVTI
QEHTMPNRKILSNIGYMAQNDALYNDLTGRENLTFFARIYMRDKEDIKKRVNLCSSMVQL
DNDLDKKVEMYSGGMKRRLSLAISFLQNPNILILDEPTVGIDPKLRQTIWKDLTKAKAED
KCIIVTTHVLDEATRCDKLVLMNQGKILATGTPDEVKKQYHTDTIEGVFLNMEG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgatagaggtaaaaaatgtaagtaaatcctttggtaaacaacaagtggtagatgatata
tctatatcatttaatgctggtgaggttgtgggtctaatcggtccttcaggtactggaaaa
acgacattaatacagtgcattttaggcatggagaaaattgatggtgggcaagtcactatt
caagaacatacaatgccgaatagaaagatattatcaaatattggttatatggctcaaaat
gatgctttatataatgatttaactggacgtgaaaatttaacgtttttcgcaagaatttat
atgcgtgataaagaagatattaaaaaacgtgtgaacctatgcagttccatggttcaatta
gacaatgatttagataagaaagttgaaatgtattctggtggaatgaaacgacgcttatct
ttagctattagctttttacaaaatcctaatatccttatattagacgaacctacagttggc
attgatcctaaattgcgtcagacgatttggaaggatttaactaaagcaaaggctgaagat
aaatgcattatagtgacaacgcatgtattagatgaagctacacgctgtgataagctcgta
ttaatgaatcaaggaaagatattggcaacgggtacaccagatgaagtgaaaaaacaatat
cacacagatacgattgaaggcgtatttctgaatatggagggataa

DBGET integrated database retrieval system