KEGG   Staphylococcus epidermidis RP62A: SEA0021Help
Entry
SEA0021           CDS       T00229                                 

Definition
(GenBank) truncated IS431mec-like transposase
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_Tnp_IS240 rve DDE_Tnp_IS66 HTH_32 DDE_3 HTH_23 HTH_28 DUF2683 DUF1580 Melibiase_2_C Cauli_DNA-bind HTH_Tnp_4 HEM4
Motif
Other DBs
NCBI-ProteinID: AAW52795
Position
pSERP:16413..17039
Genome map
AA seq 208 aa AA seqDB search
MQQNHLRYALSYRDISEILRERGVNVHHSTIYRWVQEYAPILYQIWKKKHKKAYYKWRID
ETYIKIKGKWSYLYRAIDTEGHTLDIWLRKQRDNHSAYAFIKRLIKQFGKPQKVVTDQAP
STKAAMAKIIKAFKLKPDCHCTSKYLNNLIEQDHRHIKVRKTRYQSINTAKNTLKGIECI
YALYKKNRRSLQIYGFSPCHEISIMLAS
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
ttgcaacagaaccatctaagatatgcattgagctatcgtgatatatctgaaatattaaga
gaacgtggtgtaaacgttcatcattcaacgatctaccgttgggttcaagaatatgcccca
attttatatcaaatttggaagaaaaagcataaaaaagcttattacaaatggcgtattgat
gagacgtatatcaaaataaaaggaaaatggagctatttatatcgtgccattgatacagag
ggacatacattagatatttggttgcgtaagcaacgagataatcattcagcatatgcgttt
atcaaacgtctcattaaacaatttggtaagcctcaaaaggtagttacagatcaggcacct
tcaacgaaggcagcaatggctaaaataattaaagcttttaaacttaaacctgactgtcat
tgtacatcgaaatatctgaataacctcattgagcaagatcaccgtcatattaaagtaaga
aagacaagatatcaaagtatcaatacggcaaagaatactttaaaaggtattgaatgtatt
tacgctctatataaaaagaaccgtaggtctcttcagatctacggattttccccatgccac
gaaattagcatcatgctagcaagttaa

DBGET integrated database retrieval system