KEGG   Staphylococcus epidermidis RP62A: SEA0021Help
Entry
SEA0021           CDS       T00229                                 

Definition
truncated IS431mec-like transposase
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
pSERP:16413..17039
Genome map
AA seq 208 aa AA seqDB search
MQQNHLRYALSYRDISEILRERGVNVHHSTIYRWVQEYAPILYQIWKKKHKKAYYKWRID
ETYIKIKGKWSYLYRAIDTEGHTLDIWLRKQRDNHSAYAFIKRLIKQFGKPQKVVTDQAP
STKAAMAKIIKAFKLKPDCHCTSKYLNNLIEQDHRHIKVRKTRYQSINTAKNTLKGIECI
YALYKKNRRSLQIYGFSPCHEISIMLAS
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
ttgcaacagaaccatctaagatatgcattgagctatcgtgatatatctgaaatattaaga
gaacgtggtgtaaacgttcatcattcaacgatctaccgttgggttcaagaatatgcccca
attttatatcaaatttggaagaaaaagcataaaaaagcttattacaaatggcgtattgat
gagacgtatatcaaaataaaaggaaaatggagctatttatatcgtgccattgatacagag
ggacatacattagatatttggttgcgtaagcaacgagataatcattcagcatatgcgttt
atcaaacgtctcattaaacaatttggtaagcctcaaaaggtagttacagatcaggcacct
tcaacgaaggcagcaatggctaaaataattaaagcttttaaacttaaacctgactgtcat
tgtacatcgaaatatctgaataacctcattgagcaagatcaccgtcatattaaagtaaga
aagacaagatatcaaagtatcaatacggcaaagaatactttaaaaggtattgaatgtatt
tacgctctatataaaaagaaccgtaggtctcttcagatctacggattttccccatgccac
gaaattagcatcatgctagcaagttaa

DBGET integrated database retrieval system