KEGG   Staphylococcus epidermidis RP62A: SERP0014Help
Entry
SERP0014          CDS       T00229                                 

Definition
RND efflux transporter
Orthology
K02005  
HlyD family secretion protein
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9780..10898
Genome map
AA seq 372 aa AA seqDB search
MNKKLLWSIIGIVIIVVLIIAAFILKQVNGSGSKDSNAYDTYTVRKETPISLEGKASPES
VKTYNNNQSVGNFLSVSVQDGQTVKQGERIINYDTNGNKRQQLLNKVNQAQSQVNDDYQK
VNQSPNNHQLQVKLTQDQSALNEAQQSLSQYDRQLNDSMNASFDGKINIKNDSDVGEGQP
ILQLISSNPQINATITEFDINKIKEGDEVNVTVNSTGKKGKGKILKIDELPTSYDTSDDS
TASSAQAGAQGDSEEGTEMTTSNPTINQPTGGKSGETSKYKVIIGDLDIPVRSGFSMDAK
IPLKTKKLPNNVLTKDNNVFVVDKNNKVHKREIKIERNNGEIIVKKGLKSGDKVLKSPKG
NLNDGEKVEVSS
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaataagaaactattgtggagcatcattggtattgtaattattgtcgtattaatcatt
gctgcttttatattaaaacaagttaatggttcaggtagtaaagatagtaatgcttacgat
acatatacagtaagaaaagaaacacctattagtttagaaggcaaagcgtctccagaatct
gtgaaaacttataacaataatcaatctgtgggtaacttcttaagtgtttcagtacaagat
ggtcaaacagttaaacaaggtgaacgtatcatcaattatgatacaaatgggaataaacgc
caacaactattgaacaaagtgaatcaagcacaatctcaagttaatgatgattatcaaaaa
gtaaatcaaagtcctaacaatcatcaattacaagttaaattgactcaagatcaaagtgct
ttaaatgaagctcagcagtcattgtcacaatatgacagacaactcaatgacagcatgaat
gcatcatttgatggtaaaattaacattaaaaatgattcagatgtaggcgaagggcaacct
attttgcaattaatttcttcaaatcctcaaattaacgcaactattacagagtttgatatt
aataaaattaaagaaggcgatgaagtaaatgtcactgtaaatagcacaggtaaaaaagga
aaaggaaaaattcttaaaatagatgaacttcctacaagctatgatacaagtgacgatagt
acagcatcatcggcacaagcaggggcacaaggtgatagtgaagaaggaactgaaatgacg
acatctaatcctacaattaatcagccaacaggtggtaaaagtggcgaaacatcaaaatat
aaagttatcattggtgatttagatatacccgtgagatcaggcttctctatggatgctaaa
atccctcttaaaactaaaaagctaccaaataacgtgttaacaaaagataataacgtattt
gtcgttgataaaaataataaagttcacaaacgtgaaattaaaattgaacgtaataatggt
gaaatcattgtgaaaaaaggattgaaatctggcgataaagtccttaaaagtccaaaaggt
aatttaaatgatggagaaaaagtagaggtgtcatcatga

DBGET integrated database retrieval system