KEGG   Staphylococcus epidermidis RP62A: SERP0014Help
Entry
SERP0014          CDS       T00229                                 

Definition
RND efflux transporter
Orthology
K02005  
HlyD family secretion protein
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9780..10898
Genome map
AA seq 372 aa AA seqDB search
MNKKLLWSIIGIVIIVVLIIAAFILKQVNGSGSKDSNAYDTYTVRKETPISLEGKASPES
VKTYNNNQSVGNFLSVSVQDGQTVKQGERIINYDTNGNKRQQLLNKVNQAQSQVNDDYQK
VNQSPNNHQLQVKLTQDQSALNEAQQSLSQYDRQLNDSMNASFDGKINIKNDSDVGEGQP
ILQLISSNPQINATITEFDINKIKEGDEVNVTVNSTGKKGKGKILKIDELPTSYDTSDDS
TASSAQAGAQGDSEEGTEMTTSNPTINQPTGGKSGETSKYKVIIGDLDIPVRSGFSMDAK
IPLKTKKLPNNVLTKDNNVFVVDKNNKVHKREIKIERNNGEIIVKKGLKSGDKVLKSPKG
NLNDGEKVEVSS
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaataagaaactattgtggagcatcattggtattgtaattattgtcgtattaatcatt
gctgcttttatattaaaacaagttaatggttcaggtagtaaagatagtaatgcttacgat
acatatacagtaagaaaagaaacacctattagtttagaaggcaaagcgtctccagaatct
gtgaaaacttataacaataatcaatctgtgggtaacttcttaagtgtttcagtacaagat
ggtcaaacagttaaacaaggtgaacgtatcatcaattatgatacaaatgggaataaacgc
caacaactattgaacaaagtgaatcaagcacaatctcaagttaatgatgattatcaaaaa
gtaaatcaaagtcctaacaatcatcaattacaagttaaattgactcaagatcaaagtgct
ttaaatgaagctcagcagtcattgtcacaatatgacagacaactcaatgacagcatgaat
gcatcatttgatggtaaaattaacattaaaaatgattcagatgtaggcgaagggcaacct
attttgcaattaatttcttcaaatcctcaaattaacgcaactattacagagtttgatatt
aataaaattaaagaaggcgatgaagtaaatgtcactgtaaatagcacaggtaaaaaagga
aaaggaaaaattcttaaaatagatgaacttcctacaagctatgatacaagtgacgatagt
acagcatcatcggcacaagcaggggcacaaggtgatagtgaagaaggaactgaaatgacg
acatctaatcctacaattaatcagccaacaggtggtaaaagtggcgaaacatcaaaatat
aaagttatcattggtgatttagatatacccgtgagatcaggcttctctatggatgctaaa
atccctcttaaaactaaaaagctaccaaataacgtgttaacaaaagataataacgtattt
gtcgttgataaaaataataaagttcacaaacgtgaaattaaaattgaacgtaataatggt
gaaatcattgtgaaaaaaggattgaaatctggcgataaagtccttaaaagtccaaaaggt
aatttaaatgatggagaaaaagtagaggtgtcatcatga

DBGET integrated database retrieval system