KEGG   Staphylococcus epidermidis RP62A: SERP0015Help
Entry
SERP0015          CDS       T00229                                 

Definition
(GenBank) ABC transporter, ATP-binding protein
  KO
K02003  putative ABC transport system ATP-binding protein
Organism
ser  Staphylococcus epidermidis RP62A
Module
ser_M00258  Putative ABC transport system
Brite
Transporters [BR:ser02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Putative ABC transporter [MD:M00258]
    SERP0015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 RsgA_GTPase AAA_22 AAA_23 AAA_18 MMR_HSR1 AAA_16 AAA_25 NB-ARC IstB_IS21 Rad17 ATPase_2 AAA_28 T2SSE IIGP Cytidylate_kin EF-G-binding_N AAA_24 ArgK AAA_33
Motif
Other DBs
NCBI-ProteinID: AAW53414
UniProt: Q5HS24
Position
10895..11581
Genome map
AA seq 228 aa AA seqDB search
MIELRKINRHFKNGNESNHILKDIDIHIDEGEFIAIMGPSGSGKSTLINILGFIDRGYEG
EYFFNNENYQKSSDNKLAEIRNHTVGFVFQNFKLIQNNTILENVSIPLIYNGLSNKARKS
KVLDGLHDVGLKGKENLLPNKLSGGQQQRVAIARAIINDPKFIIADEPTGALDSKTSQDI
MELFVKLNKEQNTTIIMVTHDREVAEKADRIIHILDGRVQEEEVLTRE
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgattgaattgagaaaaatcaatcgacactttaaaaatggaaatgaatcaaatcatatt
ttgaaagacatagatattcatattgatgaaggtgaatttattgctatcatgggtccgtct
ggttcaggtaaaagtacgttaattaatatcttgggatttattgatcgtggatatgaagga
gaatacttttttaacaatgagaattatcaaaaaagctcagataataagctcgcagaaatt
cgaaatcatactgtaggtttcgtctttcagaattttaaattgattcaaaataacactatt
ttagaaaatgtaagtattccgctaatttataatggtttgagtaataaagcgagaaaaagc
aaagttttagacggacttcatgacgtcggtctaaaaggtaaagagaatctcttaccaaat
aaattgtcaggagggcagcaacaacgtgtagctattgcccgggcaattattaatgaccct
aagtttattattgccgatgaacctactggcgctcttgattcgaagacatctcaagatatt
atggagcttttcgtaaaactgaacaaagaacagaatacaactattattatggtaacgcat
gatcgtgaagtggcggaaaaagctgatcgtattatccatattttggatgggcgtgtgcaa
gaggaagaggtgttgacacgtgaataa

DBGET integrated database retrieval system