KEGG   Staphylococcus epidermidis RP62A: SERP0021Help
Entry
SERP0021          CDS       T00229                                 

Definition
(GenBank) ABC transporter, ATP-binding protein
  KO
K11631  bacitracin transport system ATP-binding protein
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser02010  ABC transporters
ser02020  Two-component system
Module
ser_M00314  Bacitracin transport system
ser_M00737  Bacitracin resistance, VraDE transporter
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SERP0021
  Signal transduction
   02020 Two-component system
    SERP0021
Transporters [BR:ser02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Bacitracin transporter [MD:M00314] [OT]
    SERP0021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N RsgA_GTPase AAA_21 AAA_16 T2SSE AAA_30 AAA_29 AAA_25 AAA AAA_22 IstB_IS21 AAA_23 AAA_18 AAA_28 Rad17 ATPase_2 MMR_HSR1 ATP_bind_1 Mg_chelatase NACHT Septin AAA_33 cobW AAA_24 NB-ARC AAA_19
Motif
Other DBs
NCBI-ProteinID: AAW53420
UniProt: Q5HS18
Position
complement(17991..18749)
Genome map
AA seq 252 aa AA seqDB search
MAILTANQLSKVYGHKQKYRALNNISFSVEKGEFVAVMGPSGSGKTTLLNVLSSIDTISG
GTVEVEGKEINKLSHKEVANFRKQHLGFIFQDYSVLPTLTVKENIMLPLSVQKFHKYEME
QNYKEVAEALGIYNLGNKYPSEISGGQQQRTAAARAFVHKPTIIFADEPTGALDSKSAQD
LLHRLEDMNKQFNSTIMMVTHDPSAASYAERVIMLKDGDIHSEIYQGNDSKQTFYQEIMK
LQTALGGVSHDI
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggctattttaacagcaaatcaattatcaaaagtatatggtcacaaacaaaaatatcga
gctttaaataatataagtttttcagttgaaaaaggggaatttgtagctgtcatgggtcct
tctggatcaggtaaaacgactttactcaatgtgttaagttcaatagatactatttcagga
ggaactgtagaagttgaaggtaaagaaattaataaactgagccacaaagaagtggcaaat
tttcgaaaacaacatctcggttttatttttcaagattatagcgttttacccacattaaca
gtaaaagaaaatattatgctaccactctcagtacaaaaattccataaatatgaaatggaa
caaaattataaagaagtggctgaggcattaggtatttataacctgggaaataaatatcca
agtgaaatttctggcggtcagcaacaacgtacggcggcagcccgggcattcgtccataaa
ccaacaattattttcgcagatgaacctactggcgcattagattctaaaagtgctcaagat
ttgttacaccgtctagaagatatgaataaacaatttaattcaaccattatgatggtgaca
catgatccttcagccgctagttacgctgagagagtcattatgttgaaagacggtgatata
cactcagaaatctaccagggtaacgattcaaaacaaacattttaccaagaaattatgaaa
cttcaaaccgcattaggtggtgtcagtcatgacatttaa

DBGET integrated database retrieval system