KEGG   Staphylococcus epidermidis RP62A: SERP0021Help
Entry
SERP0021          CDS       T00229                                 

Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K11631  
bacitracin transport system ATP-binding protein
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ABC transporters
Two-component system
Module
Bacitracin transport system
Bacitracin resistance, VraDE transporter
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SERP0021
  Signal transduction
   02020 Two-component system
    SERP0021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(17991..18749)
Genome map
AA seq 252 aa AA seqDB search
MAILTANQLSKVYGHKQKYRALNNISFSVEKGEFVAVMGPSGSGKTTLLNVLSSIDTISG
GTVEVEGKEINKLSHKEVANFRKQHLGFIFQDYSVLPTLTVKENIMLPLSVQKFHKYEME
QNYKEVAEALGIYNLGNKYPSEISGGQQQRTAAARAFVHKPTIIFADEPTGALDSKSAQD
LLHRLEDMNKQFNSTIMMVTHDPSAASYAERVIMLKDGDIHSEIYQGNDSKQTFYQEIMK
LQTALGGVSHDI
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggctattttaacagcaaatcaattatcaaaagtatatggtcacaaacaaaaatatcga
gctttaaataatataagtttttcagttgaaaaaggggaatttgtagctgtcatgggtcct
tctggatcaggtaaaacgactttactcaatgtgttaagttcaatagatactatttcagga
ggaactgtagaagttgaaggtaaagaaattaataaactgagccacaaagaagtggcaaat
tttcgaaaacaacatctcggttttatttttcaagattatagcgttttacccacattaaca
gtaaaagaaaatattatgctaccactctcagtacaaaaattccataaatatgaaatggaa
caaaattataaagaagtggctgaggcattaggtatttataacctgggaaataaatatcca
agtgaaatttctggcggtcagcaacaacgtacggcggcagcccgggcattcgtccataaa
ccaacaattattttcgcagatgaacctactggcgcattagattctaaaagtgctcaagat
ttgttacaccgtctagaagatatgaataaacaatttaattcaaccattatgatggtgaca
catgatccttcagccgctagttacgctgagagagtcattatgttgaaagacggtgatata
cactcagaaatctaccagggtaacgattcaaaacaaacattttaccaagaaattatgaaa
cttcaaaccgcattaggtggtgtcagtcatgacatttaa

DBGET integrated database retrieval system