KEGG   Staphylococcus epidermidis RP62A: SERP0026Help
Entry
SERP0026          CDS       T00229                                 

Definition
sdrF protein, truncation
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
23557..23814
Genome map
AA seq 85 aa AA seqDB search
MKKRRQEPINKRVDFLSNKVNKYSIRKFTVGTASILVGATLMFGAADNEAKAAEDNQLES
ASKEEQKGSRDFEVVLCHLFIEEFQ
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagagaagacaagaaccaattaacaagagagtggattttctatccaacaaggta
aacaagtactcgattaggaagttcacagtaggtacagcttcaatactcgtgggtgctacg
ttaatgtttggtgccgcagacaatgaggctaaagcggctgaagacaatcaattagaatca
gcttcaaaagaagaacagaaaggtagtcgtgattttgaagtcgttctctgtcacctcttt
atcgaagaatttcagtga

DBGET integrated database retrieval system