KEGG   Staphylococcus epidermidis RP62A: SERP0036Help
Entry
SERP0036          CDS       T00229                                 

Definition
trans-sulfuration enzyme family protein
Orthology
K01760  
cystathionine beta-lyase [EC:4.4.1.8]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Cysteine and methionine metabolism
Selenocompound metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ser01230]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:ser00270]
Metabolism; Metabolism of other amino acids; Selenocompound metabolism [PATH:ser00450]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(32490..33665)
Genome map
AA seq 391 aa AA seqDB search
MSLSKETEVIFDVRRGKDYDSANPPLYDSSTFHQKVLGGETQYDYARSGNPNRTLLEEKL
ARLEGGKYAFAYASGIAAISAVLLTLNAGDHVILPDDVYGGTFRLTEQILNRFNIEFTTV
NATHIDHITEAIQSNTKLIYVETPSNPLFKITDIHAVATLAKEHKILLAVDNTFMTPLGQ
SPLALGADIVIHSATKFLGGHSDLIAGAAITNNREVANALYLLQNGTGTALSAYDSWALA
KHLKTLPVRFKQSVHNAERLVQFLSQREEISEVYYPGNNPTHLKQASTGGAVIGFRLKDE
SKAQKFVDSLTLPLVSVSLGGVETILSHPATMSHAAVPEDVRRERGITFGLFRLSVGLEN
PEELIADFNYALKEAFNESFTEPIKEQRFSS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtttatctaaagaaacagaagtaatattcgatgtgcgtagaggtaaagactacgac
tcagctaacccgccactttacgattcatctacattccatcaaaaagtgttaggcggtgag
actcaatatgattatgcacgaagtggtaaccctaaccgaactttacttgaagagaaactt
gcacgtttagaaggtggtaaatatgcatttgcttatgcttcaggcattgctgcaatttca
gccgttttactcacattaaacgcaggggatcatgttattttacctgatgatgtttacggg
ggcacatttagattaactgaacaaatactcaatcgattcaatattgaatttactacagtt
aacgctacacatatagatcatatcactgaagctattcaatcaaacacaaaactcatctat
gtagagacgccttcaaatccacttttcaaaattacagatattcatgctgtagcaacgcta
gcaaaggaacataagatactattagctgttgataatacgtttatgacacctttgggtcaa
tcacctttagcactaggcgctgacatagttattcatagtgcaactaaatttctaggtgga
catagcgatttaattgcaggtgcagcaattactaataatagagaggttgcaaatgcattg
tacttattacagaacggcacgggcacagccctttctgcatatgatagttgggcacttgca
aaacatcttaaaacattaccagttcgttttaaacaatctgttcataatgctgaacgtctt
gttcaatttttgagtcaaagagaggagatttctgaggtgtattacccaggaaataatcct
acacatctcaagcaagcttcaactggaggtgcagtgataggtttccgacttaaagatgaa
tctaaagcacaaaagttcgtcgattctcttactttaccacttgtatcagtgagtctcggt
ggtgtagaaactatcctatcacatcccgcaacaatgtctcatgcagcagtgccagaagat
gtgagacgtgaacgtggcatcactttcgggttattccgtttaagtgtaggtcttgagaat
ccagaagaactcatcgcagattttaactacgctttaaaggaggctttcaatgagtcattt
actgaaccaattaaagagcaacgttttagtagctga

DBGET integrated database retrieval system