KEGG   Staphylococcus epidermidis RP62A: SERP0036Help
Entry
SERP0036          CDS       T00229                                 

Definition
trans-sulfuration enzyme family protein
Orthology
K01760  
cystathionine beta-lyase [EC:4.4.1.8]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Cysteine and methionine metabolism
Selenocompound metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SERP0036
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SERP0036
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    SERP0036
Enzymes [BR:ser01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.8  cystathionine beta-lyase
     SERP0036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(32490..33665)
Genome map
AA seq 391 aa AA seqDB search
MSLSKETEVIFDVRRGKDYDSANPPLYDSSTFHQKVLGGETQYDYARSGNPNRTLLEEKL
ARLEGGKYAFAYASGIAAISAVLLTLNAGDHVILPDDVYGGTFRLTEQILNRFNIEFTTV
NATHIDHITEAIQSNTKLIYVETPSNPLFKITDIHAVATLAKEHKILLAVDNTFMTPLGQ
SPLALGADIVIHSATKFLGGHSDLIAGAAITNNREVANALYLLQNGTGTALSAYDSWALA
KHLKTLPVRFKQSVHNAERLVQFLSQREEISEVYYPGNNPTHLKQASTGGAVIGFRLKDE
SKAQKFVDSLTLPLVSVSLGGVETILSHPATMSHAAVPEDVRRERGITFGLFRLSVGLEN
PEELIADFNYALKEAFNESFTEPIKEQRFSS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtttatctaaagaaacagaagtaatattcgatgtgcgtagaggtaaagactacgac
tcagctaacccgccactttacgattcatctacattccatcaaaaagtgttaggcggtgag
actcaatatgattatgcacgaagtggtaaccctaaccgaactttacttgaagagaaactt
gcacgtttagaaggtggtaaatatgcatttgcttatgcttcaggcattgctgcaatttca
gccgttttactcacattaaacgcaggggatcatgttattttacctgatgatgtttacggg
ggcacatttagattaactgaacaaatactcaatcgattcaatattgaatttactacagtt
aacgctacacatatagatcatatcactgaagctattcaatcaaacacaaaactcatctat
gtagagacgccttcaaatccacttttcaaaattacagatattcatgctgtagcaacgcta
gcaaaggaacataagatactattagctgttgataatacgtttatgacacctttgggtcaa
tcacctttagcactaggcgctgacatagttattcatagtgcaactaaatttctaggtgga
catagcgatttaattgcaggtgcagcaattactaataatagagaggttgcaaatgcattg
tacttattacagaacggcacgggcacagccctttctgcatatgatagttgggcacttgca
aaacatcttaaaacattaccagttcgttttaaacaatctgttcataatgctgaacgtctt
gttcaatttttgagtcaaagagaggagatttctgaggtgtattacccaggaaataatcct
acacatctcaagcaagcttcaactggaggtgcagtgataggtttccgacttaaagatgaa
tctaaagcacaaaagttcgtcgattctcttactttaccacttgtatcagtgagtctcggt
ggtgtagaaactatcctatcacatcccgcaacaatgtctcatgcagcagtgccagaagat
gtgagacgtgaacgtggcatcactttcgggttattccgtttaagtgtaggtcttgagaat
ccagaagaactcatcgcagattttaactacgctttaaaggaggctttcaatgagtcattt
actgaaccaattaaagagcaacgttttagtagctga

DBGET integrated database retrieval system