KEGG   Staphylococcus epidermidis RP62A: SERP0039Help
Entry
SERP0039          CDS       T00229                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K22044  moderate conductance mechanosensitive channel
Organism
ser  Staphylococcus epidermidis RP62A
Brite
Transporters [BR:ser02000]
 Other Transporters
  Pores ion channels [TC:1]
   SERP0039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MS_channel TMEM82 DUF3810 DUF648
Motif
Other DBs
NCBI-ProteinID: AAW53424
UniProt: Q5HS00
Position
36497..37372
Genome map
AA seq 291 aa AA seqDB search
MNQLKHILSSLFEPLTKVETYENLITKVIMILIYILVAIVVIAILNKIIEQAFKIQNKSK
KGNKKRSKTLISLVQNIVKYIVWFVVITTILSKFGISVEGIIASAGVVGIAVGFGAQTIV
KDIITGFFIIFENQFDVGDYVKINSSGTTVAEGTVKSIGLRSTRINTISGELTILPNGSM
GEITNFSITNGTAIVELPVSVDENIDQVEKKLNRLFVSLRSKYYLFVSDPVVDGIDAIES
NKVTIRISAETIPGEGFSGARIIRKEAQKMFRQEGIRMPQPVISNYNEGKS
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaacttaaacatattttatcttcattgttcgaacctttaacaaaggttgaaaca
tatgaaaatttaattactaaagtaataatgattttaatttatatccttgtagcgattgtt
gttatagcaattttgaataagattattgagcaagcatttaaaattcaaaataaaagcaaa
aaaggaaataaaaaacgttcaaaaacactgatttctcttgtacaaaacatagtaaaatat
atcgtatggtttgttgttatcacaacaattttaagtaagtttggtattagcgtcgaaggt
atcatcgctagtgctggagttgtaggtattgcagttggtttcggtgcgcaaacgatagta
aaagatattattacaggtttctttattatctttgaaaatcaatttgatgtgggtgactat
gttaaaatcaatagttcaggaactacggtagcagaaggtactgtgaaatctattggttta
agatcaacgcgaattaatacaatttcgggagaactgactattttacctaatggtagcatg
ggggaaattacgaacttttcaattacaaatgggactgctattgtagaactaccagtatca
gttgatgaaaatatagatcaagttgaaaagaaactcaatcgtttatttgtttctttacgt
agtaaatattacttatttgtcagcgatccagttgttgatggtattgatgcgatagaatct
aataaggttactatacgaatttcagcagaaacaattcctggtgaaggattttcaggcgct
cgtattattcgtaaggaagctcaaaaaatgtttagacaagaaggtattcgcatgccacaa
ccagtcatttcaaattataatgaaggaaaaagctaa

DBGET integrated database retrieval system