KEGG   Staphylococcus epidermidis RP62A: SERP0052Help
Entry
SERP0052          CDS       T00229                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SERP0052
   01230 Biosynthesis of amino acids
    SERP0052
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SERP0052
  Energy metabolism
   00680 Methane metabolism
    SERP0052
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SERP0052
Enzymes [BR:ser01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SERP0052
Exosome [BR:ser04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SERP0052
  Exosomal proteins of melanoma cells
   SERP0052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
43843..44433
Genome map
AA seq 196 aa AA seqDB search
MEIYLVRHGESQSNYDNKHGYLYFCGQLDVPLTERGIKSAKELSVYFKNKYIDNVYVSDL
KRTRQTYEELFPYDIPTIYTKTLRERSLGVFEGKNKEEVCKDKRFEKYFRDPNYKYFRHS
FSQKAPQGESYQDVYDRVVTFIENELNQQQRRVVIVAHQVVIRCFFVYFKMITKEEALTT
EIHNCYPYLIKEEMKF
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggaaatttatttagtgaggcatggtgagtcacagtccaattatgataataaacacggg
tatctatatttttgtggacagttagacgtccctttgacggaaaggggtataaaaagcgct
aaagaactatctgtttattttaaaaataaatacattgacaatgtatatgtatcagattta
aaaagaacaaggcaaacgtatgaggagctatttccttatgatattccaacaatatataca
aagacgttaagagagcgttcgttaggtgtttttgaaggtaaaaataaagaagaagtttgt
aaagacaaacggttcgaaaaatatttccgtgatcctaattataaatactttagacatagc
ttttcgcaaaaagcaccacaaggagaaagttatcaagatgtctatgatagagtggttact
ttcattgaaaatgagcttaatcaacagcagagacgtgtagtgatagttgcgcaccaagtt
gtaattagatgttttttcgtctattttaaaatgataactaaggaagaagccttaacgacg
gaaattcataattgctatccatatttaattaaagaagaaatgaagttttga

DBGET integrated database retrieval system