KEGG   Staphylococcus epidermidis RP62A: SERP0059Help
Entry
SERP0059          CDS       T00229                                 

Gene name
ahpF
Definition
alkyl hydroperoxide reductase (EC:1.8.1.-)
Orthology
K03387  
alkyl hydroperoxide reductase subunit F [EC:1.6.4.-]
Organism
ser  Staphylococcus epidermidis RP62A
Brite
Enzymes [BR:ser01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.4  With a disulfide as acceptor
    1.6.4.-  
     SERP0059 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(46330..47853)
Genome map
AA seq 507 aa AA seqDB search
MLNADLKQQLQQLLELMEGDVEFVASLGSDDKSNELKELLNEMAEMSAHITITEKSLKRT
PSFSVNRPGEETGITFAGIPLGHEFNSLVLAILQVSGRAPKEKQSIIDQIKGLEGPFHFE
TFVSLTCQKCPDVVQALNLMSVINPNITHTMIDGAVFREESENIMAVPAVFLDGQEFGNG
RMTVQDILTKLGSTQDASEFNDKDPYDVLIVGGGPASGSAAIYTARKGLRTGIVADRIGG
QVNDTAGIENFITVKETTGSEFSSNLAEHIAQYDIDTMTGIRATNIEKTDSAIRVTLEND
AVLESKTVIISTGASWRKLNIPGEDRLINKGVAFCPHCDGPLFENKDVAVIGGGNSGVEA
AIDLAGIVKHVTLFEYASELKADSVLQERLRSLPNVDIKTSAKTTEVIGDDYVTGISYED
MTTGESQVVNLDGIFVQIGLVPNTSWLQNAVELNERGEVMINRDNATNVPGIFAAGDVTD
QKNKQIIISMGAGANAALNAFDYIIRN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatgctgatttaaagcaacaattacaacaattacttgagcttatggaaggcgac
gttgaattcgttgccagcctaggctctgatgataaatcaaacgaactcaaagaattatta
aatgagatggctgagatgtcagcacacataacaataactgaaaaatctttaaaacgtaca
ccaagtttttcagttaatcgccctggtgaagaaacaggtattacctttgctggcatacct
ttaggccatgaattcaactctttagtattagctatactacaagtgagtggtcgcgcacct
aaagaaaagcaatccattattgatcaaattaaagggctcgaaggtccatttcatttcgaa
acctttgtaagtcttacttgtcaaaagtgtcctgacgtcgttcaagcattaaacctaatg
agtgttattaatcctaacattactcatactatgattgatggcgctgttttccgtgaagaa
tctgaaaacattatggcagttcctgccgtcttcttagatggtcaagaatttggtaatgga
cgcatgacagttcaagatattttaactaaattaggaagcacgcaagatgcctctgaattc
aacgataaagatccttatgacgtgttaatcgttggtggcggacctgcaagtggtagtgct
gcaatttatacagcacgtaaagggctacgtacaggtattgtcgctgatcgaattggtggt
caagttaatgatactgctggtatcgagaacttcatcactgttaaagaaacgacaggttca
gagttctcatcaaatcttgcagaacatattgcacaatatgatattgatacaatgactggt
attcgtgctacaaatatcgaaaaaacagattcagctattcgcgtaactttagaaaatgat
gctgttttagaaagtaaaactgtcatcatttccacaggtgcaagttggcgtaaactaaac
atcccaggcgaagaccgtctaatcaataaaggcgtggctttctgccctcactgtgacgga
cctttatttgaaaataaagatgttgctgtcatcggtggtggtaactctggtgtagaagca
gctattgatttagccggcatcgttaaacacgtaacattatttgaatacgcttctgaatta
aaagctgatagcgtattacaagaacgtttacgctcactacctaatgttgatattaaaacg
agtgctaaaacaacagaagtaattggtgacgattacgttacaggtattagctatgaagat
atgactaccggagagtcacaagtagttaatttagatggaatatttgtacagattggatta
gttcctaatacatcttggttgcaaaatgctgtcgaattaaatgaacgtggcgaggttatg
attaatcgcgataacgcaacaaacgttcctggtatctttgcagctggtgacgttaccgat
caaaaaaataagcaaattattatttctatgggtgctggtgctaatgccgcacttaatgca
ttcgattatataattagaaattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system