KEGG   Staphylococcus epidermidis RP62A: SERP0097Help
Entry
SERP0097          CDS       T00229                                 

Definition
(GenBank) ABC transporter, ATP-binding protein
  KO
K02071  
D-methionine transport system ATP-binding protein
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ABC transporters
Module
D-Methionine transport system
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SERP0097
Transporters [BR:ser02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   D-Methionine transporter [MD:M00238] [OT]
    SERP0097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
81798..82823
Genome map
AA seq 341 aa AA seqDB search
MIEFKNVNKVFRKKRETIQALKNVSFKIDQHDIFGVIGYSGAGKSTLVRLVNQLETVSDG
QVIVDGHEIDTYKEKDLRDIKKDIGMIFQHFNLLNSKSVYKNVAMPLILSKTNKKEIKEK
VDEMLEFVGLADKKDQFPDELSGGQKQRVAIARALVTHPKILLCDEATSALDPATTSSIL
NLLSNVNRTFGVTIMMITHEMSVIQKICHRVAVMENGEVIEMGTVKDVFSHPQTNTAKNF
VSTVINTEPSKELRASFNSRKDSNFTDYKLFLDSEQIQLPILNELINEHHLNVNVLFSSM
SEIQDETVCYLWLRFEHDESFNDFKLTDYLSKRHIRYEEVI
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgattgaattcaaaaatgttaacaaagtttttcgcaaaaaaagagaaactattcaagct
ttgaaaaatgtatcatttaagattgaccaacatgatatttttggtgttattggttatagt
ggtgctggtaaaagtacattagttcggttagtcaatcaacttgagacagtatcagatggt
caagttattgttgatggtcatgagattgatacatataaagaaaaagatttacgtgatatt
aaaaaagatatcggtatgatctttcaacatttcaatttgcttaattctaaatcagtctat
aaaaatgttgcaatgccacttattttaagtaagacaaataagaaagaaattaaggaaaaa
gttgacgaaatgttagaatttgtggggcttgctgataaaaaagatcaatttccagatgaa
ttatcaggtggacaaaaacaacgtgttgccatcgcaagagcattagtaacgcatcctaaa
atattattatgtgatgaagcgacaagtgctctggatccagctactacaagctcaatttta
aatttattaagtaatgtgaatcgaacatttggtgtgacgattatgatgattacacatgaa
atgagcgtaattcaaaaaatttgtcatcgtgtagctgtcatggaaaatggcgaagtgata
gaaatggggacagttaaagatgtctttagtcatccacaaacgaacactgcaaaaaatttc
gtttcgacggtgattaacactgagccttcaaaagagttacgggcctcttttaactcgaga
aaagattcaaatttcacagattataaactgtttttagactctgaacaaattcaattgcca
atattgaacgagcttatcaacgagcatcatcttaacgttaacgtattattttcttctatg
tcagaaattcaagatgaaacggtttgttatttgtggttgagatttgagcatgatgagtca
tttaatgattttaaacttactgattacctttcaaaacgacatattcggtatgaggaggtt
atataa

DBGET integrated database retrieval system