KEGG   Staphylococcus epidermidis RP62A: SERP0098Help
Entry
SERP0098          CDS       T00229                                 

Definition
ABC transporter permease
Orthology
K02072  
D-methionine transport system permease protein
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ABC transporters
Module
D-Methionine transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:ser02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
82826..83485
Genome map
AA seq 219 aa AA seqDB search
MFGSSLDSSQLLQALYETLYMVTVSLVIGALIGIPLGILLVVTRKNGIWSNTILHQVLNP
IINILRSIPFIILLIAIVPFTKLLVGTSIGTTAAIVPLTVYVAPYIARLVENSLLEVDDG
IIEAAKAMGASPLQIIRYFLLPEALGSLILAITTAIIGLIGSTAMAGAVGGGGIGDLALV
YGYQRFDTIVIVITVIVLIIIVQIIQTLGNFIARVIRRN
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgtttggttcaagtttagattcatctcaattattacaagctctatacgaaacattgtat
atggtgactgtatcacttgtaatcggtgctttaataggtatacctcttggcatcttgtta
gtggtaactagaaaaaacggtatatggtcgaatacaatattgcatcaagtattaaatcct
atcattaatattttaagatcaattccgttcattattttattaatagccatagtgcctttt
actaaattgctagttggcacatctatcggcacaacagcagccatagtaccactcacggtt
tatgtagcaccttatatcgcacgcttagtagaaaactcattactggaagtcgatgacggg
attattgaggcagctaaagcaatgggtgcatcacctcttcaaattatacgttatttttta
ttgccagaagcacttggttcattaattctagctataactacagctattattggtctcata
ggtagtacagcaatggctggtgctgttggtggtggcggtataggtgatttggctttagtg
tatggttatcaacgattcgatacaattgtcattgtgattacagtcattgtacttattatt
attgttcaaattatacaaacgttaggtaactttatcgctagggttatccgtagaaattaa

DBGET integrated database retrieval system