KEGG   Staphylococcus epidermidis RP62A: SERP0113Help
Entry
SERP0113          CDS       T00229                                 

Definition
(GenBank) acetyltransferase, GNAT family
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 Acetyltransf_9 FR47 Acetyltransf_CG NMT Acetyltransf_4
Motif
Other DBs
NCBI-ProteinID: AAW53555
UniProt: Q5HRT0
Position
101647..102177
Genome map
AA seq 176 aa AA seqDB search
MHIYLSTLTEVDYETSLNSIENNYNLNPESSWQDRARVKNLRKLESYNYELEVIAKNELN
EVIGHVVLAEVKLSSKNKKAIALAIGALSVDKSIRNQGLGQALLKAVEERAKEQGYCAIF
VNNHPQYFEKSDYEAAHLYNIHIEEKRNHQSLLVKFLKPVQNEWSGMTVYYPEVLD
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgcatatttatttaagtactttaacagaggtcgattatgaaacgtcactaaatagtata
gaaaataattataatctaaatccagaatccagttggcaagatcgagcgcgcgttaaaaat
ctaagaaaacttgaaagctacaattatgaattagaagttatagctaagaatgaattgaat
gaagttataggtcacgttgtgttagcagaggttaagttgtcgtctaaaaacaaaaaagcg
atagcgttagccattggtgcactgtcagtagataaatctattcgaaaccaaggtttaggt
caagccctgttaaaagctgtagaagaacgtgctaaagaacaaggctattgtgctattttt
gtaaataatcatcctcagtactttgagaaatctgattatgaagcagcccatttatataat
atacatatagaagaaaaacgaaatcatcaatcattattagtaaaatttctaaaaccagtt
caaaatgaatggtctggaatgacggtgtattatccggaagtactggattga

DBGET integrated database retrieval system