KEGG   Staphylococcus epidermidis RP62A: SERP0113Help
Entry
SERP0113          CDS       T00229                                 

Definition
acetyltransferase
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
101647..102177
Genome map
AA seq 176 aa AA seqDB search
MHIYLSTLTEVDYETSLNSIENNYNLNPESSWQDRARVKNLRKLESYNYELEVIAKNELN
EVIGHVVLAEVKLSSKNKKAIALAIGALSVDKSIRNQGLGQALLKAVEERAKEQGYCAIF
VNNHPQYFEKSDYEAAHLYNIHIEEKRNHQSLLVKFLKPVQNEWSGMTVYYPEVLD
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgcatatttatttaagtactttaacagaggtcgattatgaaacgtcactaaatagtata
gaaaataattataatctaaatccagaatccagttggcaagatcgagcgcgcgttaaaaat
ctaagaaaacttgaaagctacaattatgaattagaagttatagctaagaatgaattgaat
gaagttataggtcacgttgtgttagcagaggttaagttgtcgtctaaaaacaaaaaagcg
atagcgttagccattggtgcactgtcagtagataaatctattcgaaaccaaggtttaggt
caagccctgttaaaagctgtagaagaacgtgctaaagaacaaggctattgtgctattttt
gtaaataatcatcctcagtactttgagaaatctgattatgaagcagcccatttatataat
atacatatagaagaaaaacgaaatcatcaatcattattagtaaaatttctaaaaccagtt
caaaatgaatggtctggaatgacggtgtattatccggaagtactggattga

DBGET integrated database retrieval system