KEGG   Staphylococcus epidermidis RP62A: SERP0118Help
Entry
SERP0118          CDS       T00229                                 

Definition
spermidine N1-acetyltransferase
Orthology
K00657  
diamine N-acetyltransferase [EC:2.3.1.57]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SERP0118
Enzymes [BR:ser01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.57  diamine N-acetyltransferase
     SERP0118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
111135..111668
Genome map
AA seq 177 aa AA seqDB search
MTLIIRALEKTDLSFIHHLNNEYSIMSYWFEEPYQSLSELENLYTKHILDETERRFIVEE
GSTSVGVVELLEINFIHRTCEVLIIIDPQYANNGYAKKAFKMAIDYAFLVLNMNKVYLYV
DIKNEKAVHIYQSNNFEIEGTLKEHFYTRGEYRDCYVMGLLKRNWVNKNDDDLSHIR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgactttgattattagggcattggagaagacagatttatcatttatacatcatttgaat
aatgagtattccattatgtcgtattggtttgaagagccttatcaatcattaagcgaatta
gaaaatttatatacaaagcatattttagatgaaacagagcgacgtttcattgttgaagag
ggatcaacatctgtaggcgtggtagagttattagaaattaactttatacatagaacttgt
gaagtgttaattattatcgatccgcagtatgcaaataatgggtacgcgaaaaaagccttt
aaaatggctattgactatgcttttttagtattaaatatgaataaggtatacttatatgtg
gatattaagaatgagaaagcagtacatatctatcaaagtaataatttcgaaatagaagga
acgttaaaggaacacttctatacaaggggagaatatagagattgctatgtaatgggcttg
ttaaaaaggaattgggttaataagaatgatgatgatttgtctcatataagatga

  All links  
No link information was found.   
DBGET integrated database retrieval system