KEGG   Staphylococcus epidermidis RP62A: SERP0188Help
Entry
SERP0188          CDS       T00229                                 

Gene name
fusA
Definition
elongation factor G
Orthology
K02355  
elongation factor G
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
194988..197069
Genome map
AA seq 693 aa AA seqDB search
MARDFSLKNTRNIGIMAHIDAGKTTTTERILYYTGRIHKIGETHEGASQMDWMEQEQDRG
ITITSAATTAQWQGHRVNIIDTPGHVDFTVEVERSLRVLDGAVTVLDAQSGVEPQTETVW
RQATTYGVPRIVFVNKMDKLGANFEYSVSTLHDRLQANAAPIQLPIGAEDEFEAIIDLVE
MKCFKYTNDLGTEIDEIEIPEDHKERAEEARAQLIEAVAENNDDLMEKYLGDEEISVDEL
KDAIRQATTDVEFYPVLCGTAFKNKGVQLMLNAVIDYLPSPLDVKPIIGHRANNPDEEVV
AKPDDSAEFAALAFKVMTDPYVGKLTFFRVYSGTLSSGSYVKNSSKDKRERVGRLLQMHA
NSRQEIDTVYSGEIAAAVGLKETGTGDTLCGEKNDIILESMEFPEPVIHLSVEPKSKADQ
DKMTQALVKLQEEDPTFHAHTDEETGQVIIGGMGELHLDILVDRMKKEFNVECNVGAPMV
SYRETFKQPAQVQGKFSRQSGGRGQYGDVHIEFTPNETGGGFEFENAIVGGVVPREYIPS
VEQGLKDAMENGVLAGYPLIDVKAKLFDGSYHDVDSSEMAFKIAASLALKEAAKKCDPVI
LEPMMKVTIEMPEEYMGDIMGDVTARRGRVDGMEPRGNAQVVNAYVPLSEMFGYATSLRS
NTQGRGTYTMYFDHYAEVPKSIAEEIIKKNKGE
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggcaagagacttttctttgaaaaatactcgtaatatcggtatcatggctcacattgat
gctggtaagacaactacgactgaacgtattctttactacacaggtcgtatccataaaatt
ggtgaaacacatgaaggtgcttcacaaatggactggatggaacaagagcaagaccgtggt
attactatcacatctgctgctacaactgcacaatggcaaggtcaccgtgtaaacatcatt
gatactcctggacacgtagacttcacagttgaagttgaacgttcattacgtgtacttgat
ggtgccgttactgtacttgatgcacaatcaggtgtagaacctcaaactgaaacagtttgg
cgtcaagcaacaacttatggtgtacctcgtattgtttttgtaaacaaaatggacaaatta
ggtgcgaactttgaatattcagtaagcactttacatgatcgtttacaagcaaatgcagca
cctattcaattacctattggtgcagaagatgaatttgaagcaatcattgacttagtagaa
atgaaatgctttaaatatacaaacgacctaggtacagaaatcgatgaaatcgaaattcca
gaagaccataaagaaagagctgaagaagctcgcgctcaattaattgaagctgttgctgaa
aacaacgacgatttaatggagaaatatcttggggatgaagagatttcagttgatgaatta
aaagatgctatccgccaagctactactgacgtagaattctacccagtactttgtggtaca
gcgttcaaaaacaaaggtgttcaattaatgcttaatgcagtaattgattatttaccttca
ccattagatgttaaaccaattattggtcatcgtgcgaacaaccctgatgaagaagttgtt
gctaaaccagatgattcagcagaatttgctgctttggcatttaaagttatgactgaccct
tatgttggtaaattaacattcttccgtgtatactctggaacattatcttcaggttcatat
gtgaagaactcttctaaagataaacgtgaacgtgttggacgtttattacaaatgcacgcg
aactcacgtcaagaaattgacactgtttattcaggtgaaattgcagctgcagtaggcctt
aaagaaacaggtactggtgatactttatgtggagagaaaaatgacattatcttggaatca
atggaattcccagaaccagttatccacttatcagttgaaccaaaatctaaagctgaccaa
gataaaatgactcaagctttagttaaattacaagaagaagacccaacattccatgcacac
acagatgaagaaactggacaagttatcatcggtggtatgggtgaattacacttagatatt
ttagttgaccgtatgaagaaagaattcaacgttgaatgtaacgtaggtgctccaatggtt
tcttatcgtgaaacatttaaacaacctgcacaagttcaaggtaaattctcacgtcaatct
ggtggtcgtggtcaatatggtgatgttcatattgaattcactcctaacgaaacaggtggc
ggtttcgaattcgaaaacgctattgttggtggtgtagttcctcgtgaatacattccatca
gttgaacaaggtcttaaagatgctatggaaaatggtgtcttagctggttatccattaatt
gatgttaaagctaaattatttgatggttcttatcatgatgtcgattcatctgaaatggcc
ttcaaaattgctgcatcattagcgcttaaagaagctgctaaaaaatgtgatccagttatc
ttagaaccaatgatgaaagttactatcgaaatgcctgaagaatatatgggtgatatcatg
ggtgacgtgactgctcgtcgtggacgtgtagacggtatggaaccacgtggtaatgctcaa
gttgttaacgcatatgtaccactttcagaaatgtttggttatgcaacttcattacgttct
aacacgcaaggtcgcggtacttacacaatgtactttgaccactatgcagaagttcctaaa
tcaattgctgaagaaatcatcaagaaaaataaaggtgaataa

DBGET integrated database retrieval system