KEGG   Staphylococcus epidermidis RP62A: SERP0188Help
Entry
SERP0188          CDS       T00229                                 

Gene name
fusA
Definition
elongation factor G
Orthology
K02355  
elongation factor G
Organism
ser  Staphylococcus epidermidis RP62A
Brite
Mitochondrial biogenesis [BR:ser03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SERP0188 (fusA)
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    SERP0188 (fusA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
194988..197069
Genome map
AA seq 693 aa AA seqDB search
MARDFSLKNTRNIGIMAHIDAGKTTTTERILYYTGRIHKIGETHEGASQMDWMEQEQDRG
ITITSAATTAQWQGHRVNIIDTPGHVDFTVEVERSLRVLDGAVTVLDAQSGVEPQTETVW
RQATTYGVPRIVFVNKMDKLGANFEYSVSTLHDRLQANAAPIQLPIGAEDEFEAIIDLVE
MKCFKYTNDLGTEIDEIEIPEDHKERAEEARAQLIEAVAENNDDLMEKYLGDEEISVDEL
KDAIRQATTDVEFYPVLCGTAFKNKGVQLMLNAVIDYLPSPLDVKPIIGHRANNPDEEVV
AKPDDSAEFAALAFKVMTDPYVGKLTFFRVYSGTLSSGSYVKNSSKDKRERVGRLLQMHA
NSRQEIDTVYSGEIAAAVGLKETGTGDTLCGEKNDIILESMEFPEPVIHLSVEPKSKADQ
DKMTQALVKLQEEDPTFHAHTDEETGQVIIGGMGELHLDILVDRMKKEFNVECNVGAPMV
SYRETFKQPAQVQGKFSRQSGGRGQYGDVHIEFTPNETGGGFEFENAIVGGVVPREYIPS
VEQGLKDAMENGVLAGYPLIDVKAKLFDGSYHDVDSSEMAFKIAASLALKEAAKKCDPVI
LEPMMKVTIEMPEEYMGDIMGDVTARRGRVDGMEPRGNAQVVNAYVPLSEMFGYATSLRS
NTQGRGTYTMYFDHYAEVPKSIAEEIIKKNKGE
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggcaagagacttttctttgaaaaatactcgtaatatcggtatcatggctcacattgat
gctggtaagacaactacgactgaacgtattctttactacacaggtcgtatccataaaatt
ggtgaaacacatgaaggtgcttcacaaatggactggatggaacaagagcaagaccgtggt
attactatcacatctgctgctacaactgcacaatggcaaggtcaccgtgtaaacatcatt
gatactcctggacacgtagacttcacagttgaagttgaacgttcattacgtgtacttgat
ggtgccgttactgtacttgatgcacaatcaggtgtagaacctcaaactgaaacagtttgg
cgtcaagcaacaacttatggtgtacctcgtattgtttttgtaaacaaaatggacaaatta
ggtgcgaactttgaatattcagtaagcactttacatgatcgtttacaagcaaatgcagca
cctattcaattacctattggtgcagaagatgaatttgaagcaatcattgacttagtagaa
atgaaatgctttaaatatacaaacgacctaggtacagaaatcgatgaaatcgaaattcca
gaagaccataaagaaagagctgaagaagctcgcgctcaattaattgaagctgttgctgaa
aacaacgacgatttaatggagaaatatcttggggatgaagagatttcagttgatgaatta
aaagatgctatccgccaagctactactgacgtagaattctacccagtactttgtggtaca
gcgttcaaaaacaaaggtgttcaattaatgcttaatgcagtaattgattatttaccttca
ccattagatgttaaaccaattattggtcatcgtgcgaacaaccctgatgaagaagttgtt
gctaaaccagatgattcagcagaatttgctgctttggcatttaaagttatgactgaccct
tatgttggtaaattaacattcttccgtgtatactctggaacattatcttcaggttcatat
gtgaagaactcttctaaagataaacgtgaacgtgttggacgtttattacaaatgcacgcg
aactcacgtcaagaaattgacactgtttattcaggtgaaattgcagctgcagtaggcctt
aaagaaacaggtactggtgatactttatgtggagagaaaaatgacattatcttggaatca
atggaattcccagaaccagttatccacttatcagttgaaccaaaatctaaagctgaccaa
gataaaatgactcaagctttagttaaattacaagaagaagacccaacattccatgcacac
acagatgaagaaactggacaagttatcatcggtggtatgggtgaattacacttagatatt
ttagttgaccgtatgaagaaagaattcaacgttgaatgtaacgtaggtgctccaatggtt
tcttatcgtgaaacatttaaacaacctgcacaagttcaaggtaaattctcacgtcaatct
ggtggtcgtggtcaatatggtgatgttcatattgaattcactcctaacgaaacaggtggc
ggtttcgaattcgaaaacgctattgttggtggtgtagttcctcgtgaatacattccatca
gttgaacaaggtcttaaagatgctatggaaaatggtgtcttagctggttatccattaatt
gatgttaaagctaaattatttgatggttcttatcatgatgtcgattcatctgaaatggcc
ttcaaaattgctgcatcattagcgcttaaagaagctgctaaaaaatgtgatccagttatc
ttagaaccaatgatgaaagttactatcgaaatgcctgaagaatatatgggtgatatcatg
ggtgacgtgactgctcgtcgtggacgtgtagacggtatggaaccacgtggtaatgctcaa
gttgttaacgcatatgtaccactttcagaaatgtttggttatgcaacttcattacgttct
aacacgcaaggtcgcggtacttacacaatgtactttgaccactatgcagaagttcctaaa
tcaattgctgaagaaatcatcaagaaaaataaaggtgaataa

DBGET integrated database retrieval system