KEGG   Staphylococcus epidermidis RP62A: SERP0189Help
Entry
SERP0189          CDS       T00229                                 

Gene name
tuf
Definition
elongation factor Tu (EC:3.6.5.3)
Orthology
K02358  
elongation factor Tu
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
197288..198472
Genome map
AA seq 394 aa AA seqDB search
MAKEKFDRSKEHANIGTIGHVDHGKTTLTAAIATVLAKNGDTVAQSYDMIDNAPEEKERG
ITINTAHIEYQTDKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
LLSRNVGVPALVVFLNKVDMVDDEELLELVEMEVRDLLSEYDFPGDDVPVIAGSALKALE
GDAEYEQKILDLMQAVDDYIPTPERDSDKPFMMPVEDVFSITGRGTVATGRVERGQIKVG
EEVEIIGMHETSKTTVTGVEMFRKLLDYAEAGDNIGALLRGVAREDVQRGQVLAAPGSIT
PHTKFKAEVYVLSKDEGGRHTPFFTNYRPQFYFRTTDVTGVVNLPEGTEMVMPGDNVEMT
VELIAPIAIEDGTRFSIREGGRTVGSGVVTEIFE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaaatttgatcgctcaaaagaacatgccaatattggtactatcggtcac
gttgaccatggtaaaacaactttaacagctgctatcgcaactgtattagctaaaaatggt
gacactgttgcacaatcatacgatatgattgacaacgctccagaagaaaaagaacgtggt
attacaatcaatactgcacatatcgaataccaaactgacaaacgtcactatgctcacgtt
gactgcccaggacacgctgactatgttaaaaacatgatcactggtgcagctcaaatggac
ggcggtatcttagttgtatctgctgctgacggtccaatgccacaaactcgtgaacacatc
ttattatcacgtaacgttggtgtaccagcattagttgtattcttaaacaaagttgacatg
gtagacgacgaagaattattagaattagttgaaatggaagttcgtgacttattaagcgaa
tatgacttcccaggtgacgatgtacctgtaatcgctggttctgcattaaaagcattagaa
ggcgatgctgaatacgaacaaaaaatcttagacttaatgcaagcagttgatgattacatt
ccaactccagaacgtgattctgacaaaccattcatgatgccagttgaggacgtattctca
atcactggtcgtggtactgttgctacaggccgtgttgaacgtggtcaaatcaaagttggt
gaagaagttgaaatcatcggtatgcacgaaacttctaaaacaactgttactggtgtagaa
atgttccgtaaattattagactacgctgaagctggtgacaacatcggtgctttattacgt
ggtgttgcacgtgaagacgtacaacgtggtcaagtattagctgctcctggttctattaca
ccacacacaaaattcaaagctgaagtatacgtattatctaaagatgaaggtggacgtcac
actccattcttcactaactatcgcccacaattctatttccgtactactgacgtaactggt
gttgtaaacttaccagaaggtacagaaatggttatgcctggcgacaacgttgaaatgaca
gttgaattaatcgctccaatcgctatcgaagacggaactcgtttctcaattcgtgaaggt
ggacgtactgttggatcaggcgttgtaactgaaatctttgaataa

DBGET integrated database retrieval system