KEGG   Staphylococcus epidermidis RP62A: SERP0189Help
Entry
SERP0189          CDS       T00229                                 

Gene name
tuf
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ser  Staphylococcus epidermidis RP62A
Brite
Translation factors [BR:ser03012]
 Eukaryotic Type
  Elongation factors
   SERP0189 (tuf)
 Prokaryotic Type
   SERP0189 (tuf)
Mitochondrial biogenesis [BR:ser03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SERP0189 (tuf)
Exosome [BR:ser04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SERP0189 (tuf)
  Exosomal proteins of breast cancer cells
   SERP0189 (tuf)
  Exosomal proteins of colorectal cancer cells
   SERP0189 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 CbiA cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AAW53594
UniProt: Q5HRK4
Position
197288..198472
Genome map
AA seq 394 aa AA seqDB search
MAKEKFDRSKEHANIGTIGHVDHGKTTLTAAIATVLAKNGDTVAQSYDMIDNAPEEKERG
ITINTAHIEYQTDKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
LLSRNVGVPALVVFLNKVDMVDDEELLELVEMEVRDLLSEYDFPGDDVPVIAGSALKALE
GDAEYEQKILDLMQAVDDYIPTPERDSDKPFMMPVEDVFSITGRGTVATGRVERGQIKVG
EEVEIIGMHETSKTTVTGVEMFRKLLDYAEAGDNIGALLRGVAREDVQRGQVLAAPGSIT
PHTKFKAEVYVLSKDEGGRHTPFFTNYRPQFYFRTTDVTGVVNLPEGTEMVMPGDNVEMT
VELIAPIAIEDGTRFSIREGGRTVGSGVVTEIFE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaaatttgatcgctcaaaagaacatgccaatattggtactatcggtcac
gttgaccatggtaaaacaactttaacagctgctatcgcaactgtattagctaaaaatggt
gacactgttgcacaatcatacgatatgattgacaacgctccagaagaaaaagaacgtggt
attacaatcaatactgcacatatcgaataccaaactgacaaacgtcactatgctcacgtt
gactgcccaggacacgctgactatgttaaaaacatgatcactggtgcagctcaaatggac
ggcggtatcttagttgtatctgctgctgacggtccaatgccacaaactcgtgaacacatc
ttattatcacgtaacgttggtgtaccagcattagttgtattcttaaacaaagttgacatg
gtagacgacgaagaattattagaattagttgaaatggaagttcgtgacttattaagcgaa
tatgacttcccaggtgacgatgtacctgtaatcgctggttctgcattaaaagcattagaa
ggcgatgctgaatacgaacaaaaaatcttagacttaatgcaagcagttgatgattacatt
ccaactccagaacgtgattctgacaaaccattcatgatgccagttgaggacgtattctca
atcactggtcgtggtactgttgctacaggccgtgttgaacgtggtcaaatcaaagttggt
gaagaagttgaaatcatcggtatgcacgaaacttctaaaacaactgttactggtgtagaa
atgttccgtaaattattagactacgctgaagctggtgacaacatcggtgctttattacgt
ggtgttgcacgtgaagacgtacaacgtggtcaagtattagctgctcctggttctattaca
ccacacacaaaattcaaagctgaagtatacgtattatctaaagatgaaggtggacgtcac
actccattcttcactaactatcgcccacaattctatttccgtactactgacgtaactggt
gttgtaaacttaccagaaggtacagaaatggttatgcctggcgacaacgttgaaatgaca
gttgaattaatcgctccaatcgctatcgaagacggaactcgtttctcaattcgtgaaggt
ggacgtactgttggatcaggcgttgtaactgaaatctttgaataa

DBGET integrated database retrieval system