KEGG   Staphylococcus epidermidis RP62A: SERP0199Help
Entry
SERP0199          CDS       T00229                                 

Definition
(GenBank) hydrolase, haloacid dehalogenase-like family
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser00630  Glyoxylate and dicarboxylate metabolism
ser01100  Metabolic pathways
ser01110  Biosynthesis of secondary metabolites
ser01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SERP0199
Enzymes [BR:ser01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     SERP0199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: AAW53612
UniProt: Q5HRJ4
Position
209189..209884
Genome map
AA seq 231 aa AA seqDB search
MEWILFDKDGTLIEFDSSWEKIGVRLVDQLLETFPVHDKEAAHRQLGIIDKKIKPDSVMG
SGSLGEIIESFNGVTGKETSDWTKDTSQELIDSRVPENNWIDGVQETIQALRNEGYHIGI
VTSDTKKGVDQFLEETQTRNLFDLVISTETHAEEKPHPKVLDPLFNAFDVKPEKVAIVGD
TANDMKTAINAHLGLAIGVLTGVAKKEELYDADVIINSAKDVKQVIEQYGK
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
ttggaatggatattatttgataaagatggtacattgattgagtttgacagtagttgggaa
aaaattggcgtacgtctcgttgatcaacttttagaaacctttccagtacatgataaggaa
gcggcacatcgccaattaggcattatcgataaaaaaattaagccagattctgttatggga
tcgggttcattaggtgaaattatagagtcttttaatggtgtaacaggtaaagaaacatca
gattggacaaaggatacgagtcaggaactcattgattcaagagtgcctgaaaacaattgg
attgatggtgtacaagaaactattcaagctcttagaaatgaaggatatcacataggtata
gtaacaagtgatactaaaaaaggagtcgatcaatttctggaggaaacgcaaactagaaat
ctctttgatttagtaatttctacagaaacacacgcagaagaaaagccacatcctaaagtt
ttagatccactatttaatgcttttgatgttaaaccagaaaaggtagcaatagtaggagat
acggccaacgatatgaaaaccgcgattaatgctcatttaggattagctatcggtgtgcta
acaggcgtggctaaaaaagaggaactctacgacgcagatgtcatcattaatagtgcaaaa
gatgttaaacaagttatagagcaatacggaaaataa

DBGET integrated database retrieval system