KEGG   Staphylococcus epidermidis RP62A: SERP0199Help
Entry
SERP0199          CDS       T00229                                 

Definition
HAD superfamily hydrolase
Orthology
K01091  
phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ser00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
209189..209884
Genome map
AA seq 231 aa AA seqDB search
MEWILFDKDGTLIEFDSSWEKIGVRLVDQLLETFPVHDKEAAHRQLGIIDKKIKPDSVMG
SGSLGEIIESFNGVTGKETSDWTKDTSQELIDSRVPENNWIDGVQETIQALRNEGYHIGI
VTSDTKKGVDQFLEETQTRNLFDLVISTETHAEEKPHPKVLDPLFNAFDVKPEKVAIVGD
TANDMKTAINAHLGLAIGVLTGVAKKEELYDADVIINSAKDVKQVIEQYGK
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
ttggaatggatattatttgataaagatggtacattgattgagtttgacagtagttgggaa
aaaattggcgtacgtctcgttgatcaacttttagaaacctttccagtacatgataaggaa
gcggcacatcgccaattaggcattatcgataaaaaaattaagccagattctgttatggga
tcgggttcattaggtgaaattatagagtcttttaatggtgtaacaggtaaagaaacatca
gattggacaaaggatacgagtcaggaactcattgattcaagagtgcctgaaaacaattgg
attgatggtgtacaagaaactattcaagctcttagaaatgaaggatatcacataggtata
gtaacaagtgatactaaaaaaggagtcgatcaatttctggaggaaacgcaaactagaaat
ctctttgatttagtaatttctacagaaacacacgcagaagaaaagccacatcctaaagtt
ttagatccactatttaatgcttttgatgttaaaccagaaaaggtagcaatagtaggagat
acggccaacgatatgaaaaccgcgattaatgctcatttaggattagctatcggtgtgcta
acaggcgtggctaaaaaagaggaactctacgacgcagatgtcatcattaatagtgcaaaa
gatgttaaacaagttatagagcaatacggaaaataa

DBGET integrated database retrieval system