KEGG   Staphylococcus epidermidis RP62A: SERP0209Help
Entry
SERP0209          CDS       T00229                                 

Gene name
arsC-1
Definition
arsenate reductase
Orthology
K03741  
arsenate reductase [EC:1.20.4.1]
Organism
ser  Staphylococcus epidermidis RP62A
Brite
Enzymes [BR:ser01000]
 1. Oxidoreductases
  1.20  Acting on phosphorus or arsenic in donors
   1.20.4  With disulfide as acceptor
    1.20.4.1  arsenate reductase (glutaredoxin)
     SERP0209 (arsC-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(221374..221772)
Genome map
AA seq 132 aa AA seqDB search
MQKKTIYFICTGNSCRSQMAEGFGKLILGDKWNVYSAGIETHGVNPHAIKAMKEVGIDIS
HHTSDLINNDILIASDIVVTLCSDADANCPVLPKNVTKEHWGFDDPAGKDWSEFQRVRDE
IKAAIETFAHRV
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagaaaactatttattttatttgtactggtaattcttgtcgcagtcaaatggct
gaaggttttggaaaattaatattaggtgataaatggaatgtatattctgctggcattgaa
acacatggtgttaatccgcatgctataaaagctatgaaagaagtcggtattgatatttca
catcacacttctgacctgataaacaatgacattttaatagcgtctgatatagttgtcaca
ttgtgtagtgatgcagatgcaaactgtccagttttacctaaaaacgtcactaaagaacat
tggggatttgatgatcctgctggtaaagattggtcagaatttcaacgtgtaagagatgag
attaaagcagcgatcgaaacatttgctcatagagtgtaa

DBGET integrated database retrieval system