KEGG   Staphylococcus epidermidis RP62A: SERP0211Help
Entry
SERP0211          CDS       T00229                                 

Gene name
arsR-1
Definition
arsenical resistance operon repressor
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(223077..223394)
Genome map
AA seq 105 aa AA seqDB search
MSYIQLSNILKVIANPSRLEILDLLSCGELCACDLLIHFNFSQPTLSHHMKLLVDCKLVF
ANKVGNKQIYELNHRLFEQVTNQLNLLHSTHNQCICHTIKKGEIS
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgtcatatattcaattatctaacatattaaaagtcattgcgaatcctagcagattagaa
attttagatttattatcttgtggtgaattgtgtgcgtgtgatttacttatacattttaac
ttttcacaaccaacactaagccaccatatgaagttacttgttgattgcaaattagtgttt
gcaaacaaagttggcaataaacaaatatacgaacttaatcaccgcttatttgaacaagtg
acaaatcaattaaatttacttcattcaactcataaccaatgtatttgtcatactataaag
aaaggtgaaatttcatga

DBGET integrated database retrieval system