KEGG   Staphylococcus epidermidis RP62A: SERP0242Help
Entry
SERP0242          CDS       T00229                                 

Definition
pyridine nucleotide-disulfide oxidoreductase family protein
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(249056..250387)
Genome map
AA seq 443 aa AA seqDB search
MKNYDLIIIGFGKAGKTLAAHAASHGQKVAVVEQSTKMYGGTCINIGCIPTKTLIHDGIE
GSSFKEAITRKKEVVQALNNKNYQGLNSKDNIDVLNYKANFISNEVIELQDNNGTIQETI
TADKIVINTGSRANIPDIKGIDTAQNIYDSTGLLNIDYQPQELVIIGGGYIALEFASMFA
NFGTHVTILERGDAIMTNEDQDIANLIVKDLQDKGVTINTNTSTIAFSNNKDQTIIHTNH
GEISADTVLLATGRKPNTNHLGLENTDVKIGKQGEVIVNTHLQSTVKHIYAAGDVKGGLQ
FTYISLDDYRIIKSHLFGDGSRTTENRGAIPYTVFIDPPLSRVGLIASEAKLQGYDILEN
KVFVSNIPRHKINNDSRGLFKAVINKDTKEILGASLYGKESEELISLIKLAIDQHIPYTV
LRDNIYTHPTMTESFNDLFLEPL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattatgatttgattattattggttttggaaaagcaggtaaaacattagcggca
catgctgctagtcacggacaaaaggttgcagtggtagaacaatcaacaaagatgtatggc
ggtacatgcattaatatcggatgtataccgactaaaacattaattcatgatggtattgaa
ggtagttcattcaaagaggctattactagaaaaaaagaagtcgtacaggcattgaataac
aagaactatcaaggcttaaattcaaaggacaatatagatgttctaaattataaagctaat
tttatttctaacgaggtaatagaactacaagataataatggaacaattcaagaaacaatt
acagcagataagatagtaatcaacactggttcacgtgcaaatatcccagatatcaaaggg
atagatacagctcaaaatatatatgattctactggattactaaatattgactatcaacct
caagaacttgttattattggtggtggttatatcgctctcgaattcgcttcaatgtttgca
aattttggaacacatgtaacaattcttgagcgtggtgatgctatcatgacaaatgaagat
caagacattgcaaatcttattgtcaaagatttacaagataaaggtgtgactataaacact
aatactagtactattgcattttcaaacaataaagatcaaactatcatacacacaaatcat
ggagaaatatcagctgatactgtgctcttagccacaggtcgtaagccaaatacaaatcac
ttaggtcttgaaaatacagatgtaaaaatcggaaaacaaggtgaagtaattgtaaataca
catttgcaaagtacagtgaaacacatatacgctgcaggtgatgttaaaggtggattgcaa
tttacgtatatttcactcgatgattatagaatcattaaatcacatctatttggtgatggt
tctagaacaactgaaaatcgtggtgcaataccttatacggtctttattgatcctcctcta
tctagagtaggactaattgcaagtgaggcgaaattacaaggatacgatattctagaaaat
aaagtctttgtcagtaacataccccgtcacaaaatcaataatgattccagaggtttattt
aaagcagtaattaataaagatacaaaagaaattttaggagcgtcattatatggcaaagaa
tcagaagaactgattagcttaatcaaacttgctatagatcaacatattccttacacagta
ttaagagataatatatacacacatccgacaatgaccgaatcctttaatgacttgttttta
gaaccactttga

DBGET integrated database retrieval system