KEGG   Staphylococcus epidermidis RP62A: SERP0244Help
Entry
SERP0244          CDS       T00229                                 

Definition
aldo/keto reductase
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
250971..251909
Genome map
AA seq 312 aa AA seqDB search
MVKQVRLGKSDVNVFPIALGTNAVGGHNLYPNLDEEQGKEVVRQAIDNGITLLDTAYIYG
PERSEELVGQVVKEYPREKVQIATKGSHVIKENEEVVQNNDPEYLKQQVENSLERLQVDY
IDLYYIHFPDDDTPKDKAVAALKELKDEGKIKAIGVSNFSLEQLKEANKDGYVDVVQLEY
NLLHRENEEVMAYAAENNITFVPYFPLASGILAGKYDENQTFEDHRAERPDFQPDVFKDN
VRRVKALTDIAEAHDTTIANVVLAFYLTRPSLDVVIPGAKRAEQVVENIDAANIELSQGE
IDKIDSLFPIKK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacaagtacgattaggtaaatctgatgtcaatgtttttcctatcgcattaggt
acaaatgcagtaggtggtcataatttatatcctaatttggatgaagagcaagggaaagaa
gttgtacgtcaagctattgataatggtataacattattagatacagcatatatctacggg
cctgaacgttctgaagaattagttggacaagttgtaaaagaatatccacgcgagaaagtg
caaattgcaacaaaaggttcgcatgttattaaagaaaatgaagaagttgttcaaaataac
gatccagaatatttaaaacagcaagttgaaaatagtttggaacgtcttcaagtggattat
attgatttgtattatattcattttcctgatgacgatacaccaaaagataaagcggtggcg
gctcttaaagagcttaaagatgaaggtaaaattaaagcaataggtgtatctaatttctct
ttagaacaattaaaagaagcgaataaagatggatatgttgatgttgttcaattagaatac
aatttattacatcgtgaaaatgaagaagtaatggcatatgctgcagaaaataatattaca
tttgttccttacttcccacttgcttcaggtatactagctggcaagtacgatgaaaatcaa
acatttgaggatcatcgtgcagaacgtcctgattttcaaccagacgtattcaaagataat
gtgcgtcgtgtaaaagcattaactgatattgcagaggcacatgatacaacgattgccaat
gtcgtattagcattttatcttacacgtccatcactagatgttgtcatccctggtgcaaaa
cgtgcagagcaagttgttgaaaatattgatgctgcaaatattgaattatcgcaaggtgaa
atagacaaaattgatagtttattcccaattaaaaaataa

DBGET integrated database retrieval system