KEGG   Staphylococcus epidermidis RP62A: SERP0249Help
Entry
SERP0249          CDS       T00229                                 

Definition
IS431mec-like transposase
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
257149..257823
Genome map
AA seq 224 aa AA seqDB search
MNYFRYKQFNKDVITVAVGYYLRYALSYRDISEILRERGVNVHHSTVYRWVQEYAPILYQ
IWKKKHKKAYDKWRIDETYINIKGKWNYLYRAIDAEGHTLDIWLRKQRDNHSAYVFIKRL
IKQFGKSQKVITDQAPSTKVAMAKVIKAFKLKPDCHCTSKYLNNLIEQDHRHIKVRKTRY
QSINTAKNTLKGIECIYALYKKNRRSLQIYGFSPCHEISIMLAS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaactatttcagatataaacaatttaacaaggatgttatcactgtagccgttggctac
tatctaagatatgcattgagttatcgtgatatatctgaaatattaagggaacgtggtgta
aacgttcatcattcaacggtctatcgttgggttcaagaatatgccccgattttatatcag
atttggaagaaaaagcataaaaaagcttatgacaaatggcgtattgatgagacgtacatc
aatataaaaggaaaatggaactatttatatcgtgccattgatgcagagggacatacatta
gatatttggttgcgtaagcaacgagataatcattcagcatatgtatttatcaaacgtctc
attaaacaatttggtaaatctcaaaaggtaattacagatcaggcaccttcaacgaaggtc
gcaatggctaaagtcattaaagcttttaaacttaaacctgactgtcattgtacatcgaaa
tatctgaataatctcattgagcaagatcaccgtcatattaaagtaagaaagacaagatat
caaagtatcaatacggcaaagaatactttaaaaggtattgaatgtatttacgctctatat
aaaaagaaccgcaggtctcttcagatctacggattttccccatgccacgaaattagcatc
atgctagcaagttaa

DBGET integrated database retrieval system