KEGG   Staphylococcus epidermidis RP62A: SERP0313Help
Entry
SERP0313          CDS       T00229                                 

Definition
sensor histidine kinase
Orthology
K11629  
two-component system, OmpR family, bacitracin resistance sensor histidine kinase BceS [EC:2.7.13.3]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Two-component system
Module
BceS-BceR (bacitracin transport) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ser02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
316151..317191
Genome map
AA seq 346 aa AA seqDB search
MNNFRWFWFFIKSRINWILWILFLNIILLGVAYIDYEISVESVFYIVILNVGLSILFLLF
TFVKEVRLSKHFYEDKEIEEIKHKDLAETPFQQQVIDYLYRHIAAQKEKVVEQQLQIKNH
EQTITEFVHDIKTPVTAMKLLIDQENDDQRKRALLFEWSRINEMLDKQLYLTRLETHHRD
MYFDYISLKRMVIDEIQVTRHISQAKGIGFELDFKDEQKVYTDVKWCRMMIRQVLSNSLK
YSDNSTINLSGYNIEGHVVLKIKDYGRGISKRDLPRIFDRGFTSTTDRNDTASSGMGLYL
VQSVKEQLGIEVKVDSIVGKGTTFYFIFPQQNEIIERMSKVTRLSF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaataattttcgatggttttggttttttataaaatctcgtattaattggatattgtgg
atattatttctcaacattattttattaggtgttgcctacatagattatgagatttcagtt
gaaagtgtattttatatagtgatattaaacgtaggattgagtatacttttcttattattt
acgtttgttaaagaagtccgtctatctaaacatttttatgaagataaagaaattgaagaa
attaagcataaagatttggcagaaaccccatttcaacaacaagtcatagattatctgtat
cgtcatatagccgctcaaaaagagaaagtagtcgaacaacaattacaaattaaaaatcat
gaacaaacaattacagagtttgttcatgatataaaaacacctgttacggctatgaaatta
ttgatagatcaagagaatgatgatcagcgtaagcgagcgttattatttgaatggtctcgt
attaatgagatgttagataagcaattatatttaacaaggcttgaaacacatcatcgtgat
atgtattttgattatatttcattaaagagaatggttatagatgaaatacaagttactcga
catatcagtcaggcaaaagggataggttttgaattagattttaaagacgaacaaaaggtt
tatacagatgttaaatggtgccgtatgatgattaggcaagttctatctaactctttgaaa
tatagtgataattctacaataaatttaagtggttataacatagaaggacacgttgtttta
aaaattaaagactacggtcgtggaattagtaaaagagatttaccacgtatatttgataga
ggatttacttctacaacagaccgcaacgatactgcgtcttctggtatgggattatacctt
gtacaaagcgtgaaagaacaacttgggattgaagttaaagttgattcaatagtggggaaa
ggaacaacgttttatttcattttcccacaacaaaatgaaatcattgagcgcatgtctaaa
gtgacaagattgtcattttaa

DBGET integrated database retrieval system