KEGG   Staphylococcus epidermidis RP62A: SERP0313Help
Entry
SERP0313          CDS       T00229                                 

Definition
(GenBank) sensor histidine kinase
  KO
K19077  
two-component system, OmpR family, sensor histidine kinase GraS [EC:2.7.13.3]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Cationic antimicrobial peptide (CAMP) resistance
Two-component system
Module
Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon
Cationic antimicrobial peptide (CAMP) resistance, lysyl-phosphatidylglycerol (L-PG) synthase MprF
Cationic antimicrobial peptide (CAMP) resistance, VraFG transporter
GraS-GraR (cationic antimicrobial peptide transport) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SERP0313
 Human Diseases
  Antimicrobial resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    SERP0313
Enzymes [BR:ser01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     SERP0313
Protein kinases [BR:ser01001]
 Histidine protein kinases
  OmpR family
   SERP0313
Two-component system [BR:ser02022]
 OmpR family
  GraS-GraR [MD:M00733]
   SERP0313
Antimicrobial resistance genes [BR:ser01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    SERP0313
   Cationic antimicrobial peptide (CAMP) resistance, lysyl-phosphatidylglycerol (L-PG) synthase MprF [MD:M00726]
    SERP0313
   Cationic antimicrobial peptide (CAMP) resistance, VraFG transporter [MD:M00730]
    SERP0313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
316151..317191
Genome map
AA seq 346 aa AA seqDB search
MNNFRWFWFFIKSRINWILWILFLNIILLGVAYIDYEISVESVFYIVILNVGLSILFLLF
TFVKEVRLSKHFYEDKEIEEIKHKDLAETPFQQQVIDYLYRHIAAQKEKVVEQQLQIKNH
EQTITEFVHDIKTPVTAMKLLIDQENDDQRKRALLFEWSRINEMLDKQLYLTRLETHHRD
MYFDYISLKRMVIDEIQVTRHISQAKGIGFELDFKDEQKVYTDVKWCRMMIRQVLSNSLK
YSDNSTINLSGYNIEGHVVLKIKDYGRGISKRDLPRIFDRGFTSTTDRNDTASSGMGLYL
VQSVKEQLGIEVKVDSIVGKGTTFYFIFPQQNEIIERMSKVTRLSF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaataattttcgatggttttggttttttataaaatctcgtattaattggatattgtgg
atattatttctcaacattattttattaggtgttgcctacatagattatgagatttcagtt
gaaagtgtattttatatagtgatattaaacgtaggattgagtatacttttcttattattt
acgtttgttaaagaagtccgtctatctaaacatttttatgaagataaagaaattgaagaa
attaagcataaagatttggcagaaaccccatttcaacaacaagtcatagattatctgtat
cgtcatatagccgctcaaaaagagaaagtagtcgaacaacaattacaaattaaaaatcat
gaacaaacaattacagagtttgttcatgatataaaaacacctgttacggctatgaaatta
ttgatagatcaagagaatgatgatcagcgtaagcgagcgttattatttgaatggtctcgt
attaatgagatgttagataagcaattatatttaacaaggcttgaaacacatcatcgtgat
atgtattttgattatatttcattaaagagaatggttatagatgaaatacaagttactcga
catatcagtcaggcaaaagggataggttttgaattagattttaaagacgaacaaaaggtt
tatacagatgttaaatggtgccgtatgatgattaggcaagttctatctaactctttgaaa
tatagtgataattctacaataaatttaagtggttataacatagaaggacacgttgtttta
aaaattaaagactacggtcgtggaattagtaaaagagatttaccacgtatatttgataga
ggatttacttctacaacagaccgcaacgatactgcgtcttctggtatgggattatacctt
gtacaaagcgtgaaagaacaacttgggattgaagttaaagttgattcaatagtggggaaa
ggaacaacgttttatttcattttcccacaacaaaatgaaatcattgagcgcatgtctaaa
gtgacaagattgtcattttaa

DBGET integrated database retrieval system