KEGG   Staphylococcus epidermidis RP62A: SERP0313Help
Entry
SERP0313          CDS       T00229                                 

Definition
(RefSeq) sensor histidine kinase
  KO
K19077  
two-component system, OmpR family, sensor histidine kinase GraS [EC:2.7.13.3]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Cationic antimicrobial peptide (CAMP) resistance
Two-component system
Module
Cationic antimicrobial peptide (CAMP) resistance, addition of alanine to teichoic acids
Cationic antimicrobial peptide (CAMP) resistance, addition of lysine to phospholipids
Cationic antimicrobial peptide (CAMP) resistance, VraFG transporter
GraS-GraR (cationic antimicrobial peptide transport) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SERP0313
 Human Diseases
  Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    SERP0313
Enzymes [BR:ser01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     SERP0313
Protein kinases [BR:ser01001]
 Histidine protein kinases
  OmpR family
   SERP0313
Two-component system [BR:ser02022]
 OmpR family
  GraS-GraR [MD:M00733]
   SERP0313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
316151..317191
Genome map
AA seq 346 aa AA seqDB search
MNNFRWFWFFIKSRINWILWILFLNIILLGVAYIDYEISVESVFYIVILNVGLSILFLLF
TFVKEVRLSKHFYEDKEIEEIKHKDLAETPFQQQVIDYLYRHIAAQKEKVVEQQLQIKNH
EQTITEFVHDIKTPVTAMKLLIDQENDDQRKRALLFEWSRINEMLDKQLYLTRLETHHRD
MYFDYISLKRMVIDEIQVTRHISQAKGIGFELDFKDEQKVYTDVKWCRMMIRQVLSNSLK
YSDNSTINLSGYNIEGHVVLKIKDYGRGISKRDLPRIFDRGFTSTTDRNDTASSGMGLYL
VQSVKEQLGIEVKVDSIVGKGTTFYFIFPQQNEIIERMSKVTRLSF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaataattttcgatggttttggttttttataaaatctcgtattaattggatattgtgg
atattatttctcaacattattttattaggtgttgcctacatagattatgagatttcagtt
gaaagtgtattttatatagtgatattaaacgtaggattgagtatacttttcttattattt
acgtttgttaaagaagtccgtctatctaaacatttttatgaagataaagaaattgaagaa
attaagcataaagatttggcagaaaccccatttcaacaacaagtcatagattatctgtat
cgtcatatagccgctcaaaaagagaaagtagtcgaacaacaattacaaattaaaaatcat
gaacaaacaattacagagtttgttcatgatataaaaacacctgttacggctatgaaatta
ttgatagatcaagagaatgatgatcagcgtaagcgagcgttattatttgaatggtctcgt
attaatgagatgttagataagcaattatatttaacaaggcttgaaacacatcatcgtgat
atgtattttgattatatttcattaaagagaatggttatagatgaaatacaagttactcga
catatcagtcaggcaaaagggataggttttgaattagattttaaagacgaacaaaaggtt
tatacagatgttaaatggtgccgtatgatgattaggcaagttctatctaactctttgaaa
tatagtgataattctacaataaatttaagtggttataacatagaaggacacgttgtttta
aaaattaaagactacggtcgtggaattagtaaaagagatttaccacgtatatttgataga
ggatttacttctacaacagaccgcaacgatactgcgtcttctggtatgggattatacctt
gtacaaagcgtgaaagaacaacttgggattgaagttaaagttgattcaatagtggggaaa
ggaacaacgttttatttcattttcccacaacaaaatgaaatcattgagcgcatgtctaaa
gtgacaagattgtcattttaa

DBGET integrated database retrieval system