KEGG   Staphylococcus epidermidis RP62A: SERP0314Help
Entry
SERP0314          CDS       T00229                                 

Definition
ABC transporter ATP-binding protein
Orthology
K11631  
bacitracin transport system ATP-binding protein
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ABC transporters
Two-component system
Staphylococcus aureus infection
Module
Bacitracin transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:ser02010]
Environmental Information Processing; Signal transduction; Two-component system [PATH:ser02020]
Human Diseases; Infectious diseases; Staphylococcus aureus infection [PATH:ser05150]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
317337..318098
Genome map
AA seq 253 aa AA seqDB search
MSILEVRQLSKVYGDKQAFQEVLKEINLDVDEGEFISIMGPSGSGKTTLLNVLSSIDYMT
KGSITINGKQLEKLSNKQLSDIRKKDIGFIFQDYNILNTLTVKENIMLPLSVQKLDKQIM
HERYQRIVEALNISDISDKYPSELSGGQRQRTSAARAFINLPSIIFADEPTGALDSKSTL
DLLKRLKYMNEEFNTTILMVTHDPVAASFSNRVVMLKDGQIFTELYQGDDDKQTFYKEII
RTQSVLGGINYEL
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgatattagaggtaagacagttgtcaaaagtctatggtgataagcaagctttccaa
gaagttttgaaagaaattaatttagatgttgatgaaggtgagtttatatcaattatggga
ccttctggttcaggaaagacaactttattaaatgtacttagttcgattgattatatgact
aaaggatctattacaatcaacgggaaacaacttgagaagttatctaataagcaattatct
gatattagaaaaaaagatattggatttatttttcaagattataatattttaaatacctta
accgttaaagaaaatatcatgcttccactatcagttcaaaagttagataaacaaataatg
catgaacgttatcaacgtatagtagaagctttgaacattagtgatattagtgataaatat
ccatcagagttgtcaggtggacagcgtcaacgtacctcagcagcaagggcatttattaat
ttaccttcaattatatttgctgatgagcctacaggtgctttagattctaaaagtacacta
gatttacttaagcgtcttaaatatatgaatgaggaatttaacacaaccatacttatggtg
acacatgatccagtagcggctagtttttcaaaccgtgttgtgatgttaaaggatggacaa
atctttactgagttgtatcaaggtgatgatgataaacaaacgttttataaagaaattata
agaacgcaaagtgtacttggtggcatcaattatgagctttaa

DBGET integrated database retrieval system