KEGG   Staphylococcus epidermidis RP62A: SERP0314Help
Entry
SERP0314          CDS       T00229                                 

Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K19079  
cationic antimicrobial peptide transport system ATP-binding protein
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Cationic antimicrobial peptide (CAMP) resistance
ABC transporters
Two-component system
Staphylococcus aureus infection
Module
Cationic antimicrobial peptide (CAMP) resistance, VraFG transporter
Cationic antimicrobial peptide transport system
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SERP0314
  Signal transduction
   02020 Two-component system
    SERP0314
 Human Diseases
  Infectious diseases
   05150 Staphylococcus aureus infection
    SERP0314
  Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    SERP0314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
317337..318098
Genome map
AA seq 253 aa AA seqDB search
MSILEVRQLSKVYGDKQAFQEVLKEINLDVDEGEFISIMGPSGSGKTTLLNVLSSIDYMT
KGSITINGKQLEKLSNKQLSDIRKKDIGFIFQDYNILNTLTVKENIMLPLSVQKLDKQIM
HERYQRIVEALNISDISDKYPSELSGGQRQRTSAARAFINLPSIIFADEPTGALDSKSTL
DLLKRLKYMNEEFNTTILMVTHDPVAASFSNRVVMLKDGQIFTELYQGDDDKQTFYKEII
RTQSVLGGINYEL
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgatattagaggtaagacagttgtcaaaagtctatggtgataagcaagctttccaa
gaagttttgaaagaaattaatttagatgttgatgaaggtgagtttatatcaattatggga
ccttctggttcaggaaagacaactttattaaatgtacttagttcgattgattatatgact
aaaggatctattacaatcaacgggaaacaacttgagaagttatctaataagcaattatct
gatattagaaaaaaagatattggatttatttttcaagattataatattttaaatacctta
accgttaaagaaaatatcatgcttccactatcagttcaaaagttagataaacaaataatg
catgaacgttatcaacgtatagtagaagctttgaacattagtgatattagtgataaatat
ccatcagagttgtcaggtggacagcgtcaacgtacctcagcagcaagggcatttattaat
ttaccttcaattatatttgctgatgagcctacaggtgctttagattctaaaagtacacta
gatttacttaagcgtcttaaatatatgaatgaggaatttaacacaaccatacttatggtg
acacatgatccagtagcggctagtttttcaaaccgtgttgtgatgttaaaggatggacaa
atctttactgagttgtatcaaggtgatgatgataaacaaacgttttataaagaaattata
agaacgcaaagtgtacttggtggcatcaattatgagctttaa

DBGET integrated database retrieval system