KEGG   Staphylococcus epidermidis RP62A: SERP0314Help
Entry
SERP0314          CDS       T00229                                 

Definition
(GenBank) ABC transporter, ATP-binding protein
  KO
K19079  
cationic antimicrobial peptide transport system ATP-binding protein
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Cationic antimicrobial peptide (CAMP) resistance
ABC transporters
Two-component system
Staphylococcus aureus infection
Module
Cationic antimicrobial peptide (CAMP) resistance, VraFG transporter
Cationic antimicrobial peptide transport system
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SERP0314
  Signal transduction
   02020 Two-component system
    SERP0314
 Human Diseases
  Infectious diseases
   05150 Staphylococcus aureus infection
    SERP0314
  Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    SERP0314
Transporters [BR:ser02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Cationic antimicrobial peptide transporter [MD:M00732] [OT]
    SERP0314
Antimicrobial resistance genes [BR:ser01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, VraFG transporter [MD:M00730]
    SERP0314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
317337..318098
Genome map
AA seq 253 aa AA seqDB search
MSILEVRQLSKVYGDKQAFQEVLKEINLDVDEGEFISIMGPSGSGKTTLLNVLSSIDYMT
KGSITINGKQLEKLSNKQLSDIRKKDIGFIFQDYNILNTLTVKENIMLPLSVQKLDKQIM
HERYQRIVEALNISDISDKYPSELSGGQRQRTSAARAFINLPSIIFADEPTGALDSKSTL
DLLKRLKYMNEEFNTTILMVTHDPVAASFSNRVVMLKDGQIFTELYQGDDDKQTFYKEII
RTQSVLGGINYEL
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgatattagaggtaagacagttgtcaaaagtctatggtgataagcaagctttccaa
gaagttttgaaagaaattaatttagatgttgatgaaggtgagtttatatcaattatggga
ccttctggttcaggaaagacaactttattaaatgtacttagttcgattgattatatgact
aaaggatctattacaatcaacgggaaacaacttgagaagttatctaataagcaattatct
gatattagaaaaaaagatattggatttatttttcaagattataatattttaaatacctta
accgttaaagaaaatatcatgcttccactatcagttcaaaagttagataaacaaataatg
catgaacgttatcaacgtatagtagaagctttgaacattagtgatattagtgataaatat
ccatcagagttgtcaggtggacagcgtcaacgtacctcagcagcaagggcatttattaat
ttaccttcaattatatttgctgatgagcctacaggtgctttagattctaaaagtacacta
gatttacttaagcgtcttaaatatatgaatgaggaatttaacacaaccatacttatggtg
acacatgatccagtagcggctagtttttcaaaccgtgttgtgatgttaaaggatggacaa
atctttactgagttgtatcaaggtgatgatgataaacaaacgttttataaagaaattata
agaacgcaaagtgtacttggtggcatcaattatgagctttaa

DBGET integrated database retrieval system