KEGG   Staphylococcus epidermidis RP62A: SERP0340Help
Entry
SERP0340          CDS       T00229                                 

Definition
ABC transporter ATP-binding protein
Orthology
K16013  
ATP-binding cassette, subfamily C, bacterial CydD
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ABC transporters
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:ser02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
341329..342963
Genome map
AA seq 544 aa AA seqDB search
MKKLTKMVLSYKLYPTLMLIMSVFLSFTVVAQNISISHFLNHLLYYQQQSLLLLLSVIFI
SLILRATFNMLIQFLGDHLAFKVKHMLREQVILKKSVRSIGEEINILTESIDGIGPFFQS
YLPQVFKSMLIPIVIIITMCFVHLPTAIIMIVTAPFIPLFYVIFGLKTRDESKDQMTYLN
QFSQRFLNTAKGLITFKLLNQTKQSEQQLYKDSTRFRDLTMRILKSAFLSGLMLEFISML
GIGLVALEAALSLVVFNHINFVTAAIAIILAPEFYNAIKDLGQAFHTGKQSEGASDVVFS
FLESEDKADSPTLKVDEQQFEQVLIKHVDFQYANSNHMALKNISFSVNKGEKVAIVGPSG
AGKSTLAKLLSQSVTPTHGTLSFNQASLNIGFLSQRPHIFADSIKNNIAMYDDEICDEQV
IQVLDEVGLKEKVLSLKYGIYTSIGEGGEMLSGGQMRRIELSRLLLLKPDIVIFDEPAIG
LDIETEKVIQQVLEHHFSTTTVFIIAHRDSTIRSSARRIYIESGHLIKDDSIISVTRSEV
KIDQ
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaactaacaaaaatggttttaagttataaattataccccacactcatgttaatc
atgagcgtttttttatcttttacggtcgttgcgcaaaacatttcaatttcacacttttta
aatcacttactgtattatcaacaacaatctttattattattgttatcagttatttttatc
tctcttattttaagagcaacatttaatatgctgattcaatttttaggagatcatttggca
tttaaagtaaaacatatgcttagagaacaagtgattttgaaaaaaagtgtccgttcaatt
ggtgaagaaataaatattttaactgaaagtattgatggtatcggtccgttctttcagagt
tatttacctcaagtctttaaatcaatgttgattcccatcgttattattattaccatgtgt
tttgttcatttacctactgctattattatgatagttaccgcaccttttattccattgttt
tatgttatttttggacttaaaacaagagatgagtcaaaggatcaaatgacatatttaaac
cagtttagtcaacgttttttaaatacagctaaaggtcttattacatttaaacttttaaat
caaacgaaacaatctgagcaacaactttataaagacagtacacgttttagagatttaaca
atgcgtattttgaaaagtgcctttttatcaggacttatgcttgagttcataagtatgtta
gggattggattggtcgcattggaagcggctttaagcttagttgtatttaaccatatcaac
tttgtgactgcagcgatagcgattattttagctcctgaattttataatgcgattaaagat
ttaggtcaagcatttcatacaggtaagcaaagtgaaggtgctagcgatgtggtgttttca
tttttagaatctgaagataaagctgattctcctacattaaaagtggatgagcaacagttt
gaacaagttttaattaagcatgttgattttcaatacgctaatagtaatcatatggctttg
aaaaacatttctttttcggtaaataaaggagaaaaggtcgctattgtgggaccgagtggt
gcagggaaatccactttagctaagttgcttagtcaatcagtaacacccacacatggaaca
ctttcatttaaccaagcatcattaaatatcggatttctaagtcagcgcccacatatattt
gcagattctatcaaaaataatattgcaatgtatgatgatgagatatgtgatgagcaagtg
attcaagtgcttgatgaagtggggttaaaagagaaagtactttcattaaaatatggtatc
tatacttctattggtgaaggtggggaaatgttatcaggtggacaaatgagacgtattgag
ttaagtcgtttattattattgaaaccagatattgtaatttttgatgaaccagcgatagga
ttagatattgaaactgaaaaggtcatacaacaagtattagagcatcatttttctacaacg
acagtgtttattattgcacaccgtgattcaaccattcgaagttcagcacggcgtatatat
atcgaaagtggtcatcttataaaagatgattcgataatttctgttacgcgtagtgaggtg
aagatagatcaatga

DBGET integrated database retrieval system