KEGG   Staphylococcus epidermidis RP62A: SERP0341Help
Entry
SERP0341          CDS       T00229                                 

Definition
ABC transporter ATP-binding protein
Orthology
K16012  
ATP-binding cassette, subfamily C, bacterial CydC
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ABC transporters
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SERP0341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
342960..344654
Genome map
AA seq 564 aa AA seqDB search
MKSHIHFSIDRDLICAIMVGVLSGIVTLAMFFLSGYMITQSALGAPLYALMILVVSVKLF
GFLRAITRYIERLLSHKTTFTMLRNVRVQFLKMLYPVVPDIYRRFNSSDLITKMISRVEA
LQNIYLRVYYPPIVIGLTAIVSVITMLFLSPLHALVITLSMLLTLWIVPWLSAMKARKLK
QQVTQTQKTFLKRYYDYKEGHEELKRFNRSDDFENTVSQSLRQFDDMQLKERRFLSIYDY
LLNLIAMFSIFMCLVLGAQQIHDGQLNAIYITSIILMILTLFEQAVPMSNVAYYKADTDL
ALEEIQEVIVPKYKIPSEHTNLKRSQNLLLEIKNVTFKYEHQHHSTLKQINLTIEYGDKV
AIIGPSGSGKSTLLHVLLGLYQIEEGEVRLNGKDMNSINDNDKYQTFNAMLQSQYIFDGS
IRDNLFSEQSDDNLKKVLEDVGLEYLNLDSIVTLDGHNLSGGEAQRLSLARLLLRPSAGF
WILDEPTTALDINNTQKIINLIESLSQTLIIATHDLEILPRFNKIIVMNDGEIIENDSYQ
ELMQHDGYLKKVIEMNGNEMKFFN
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcacatattcattttagtatagatagagatttaatatgcgctatcatggtaggt
gttttaagcggaattgtaacattagcaatgttctttttaagtggttatatgattactcaa
agtgcgctaggtgcgccactttatgcattaatgattttagttgtatctgttaaattgttt
ggttttttaagagcaattacacgctatatagaaagattactttcacacaagacgacattt
acaatgttacgtaatgtacgagttcaatttttaaaaatgctatatccagtcgttccagat
atctatagaagatttaattcaagtgatcttattacaaaaatgataagccgtgtagaagct
ttacaaaacatatatctgagagtatattacccaccgattgtaatcggattaactgcaatt
gtttcagtaataactatgttgtttttatctccactacatgcattagtgattactttaagt
atgttattaactttatggattgttccttggttaagtgctatgaaagcacgtaaattaaag
caacaagtgacccaaacgcaaaaaacatttcttaaaagatattatgattataaagaaggt
catgaagaattaaaacgtttcaatcgcagcgatgacttcgaaaatacagtttcccagtct
ttacgacaatttgatgatatgcaacttaaggaacgccgatttctttctatttatgactac
ttgttaaacttaatagcgatgttctcaatatttatgtgtttagtgttaggtgcgcaacag
attcatgatggtcagctcaatgctatttatattacaagtattatattgatgatattaact
ttatttgaacaagcagtacctatgagcaatgtggcatattataaagcagatacagacctg
gcacttgaagagatacaagaggttattgtacctaagtataaaattccttcagaacataca
aacttaaagcgttcgcaaaatcttttattagaaattaaaaatgtcacatttaaatatgaa
catcaacatcattctactttaaaacagattaatctaaccattgaatatggtgataaggtg
gcaatcattggtccttcaggatcaggtaaaagtactttgcttcatgtattacttgggcta
tatcaaatagaagagggagaagtgagattaaatggtaaggatatgaacagtatcaatgac
aatgataaatatcaaacatttaatgcaatgcttcaatctcaatatatttttgatggttca
attcgtgataatttattttctgagcaatcagatgataacctcaaaaaggttctcgaagat
gttggattagaatatttaaatttagatagtatagttacgttagacggtcataatttatca
ggtggggaagctcaacgtctaagtttagcgagattgctattaagaccttcggccggtttt
tggatattagatgaacctactacagcactagatattaataatacccaaaaaattataaat
ttgattgaatccttatcccaaacactcatcatagctacacatgatttagaaatacttcca
agatttaataaaattatagtcatgaatgacggagaaataatagaaaatgattcatatcaa
gaattaatgcagcatgacggttatttaaaaaaagtaatagaaatgaatggaaacgaaatg
aaattttttaattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system