KEGG   Staphylococcus epidermidis RP62A: SERP0364Help
Entry
SERP0364          CDS       T00229                                 

Gene name
saeS
Definition
sensor histidine kinase SaeS
Orthology
K10681  
two-component system, OmpR family, sensor histidine kinase SaeS [EC:2.7.13.3]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Two-component system
Module
SaeS-SaeR (staphylococcal virulence regulation) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SERP0364 (saeS)
Enzymes [BR:ser01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     SERP0364 (saeS)
Protein kinases [BR:ser01001]
 Histidine protein kinases
  OmpR family
   SERP0364 (saeS)
Two-component system [BR:ser02022]
 OmpR family
  SaeS-SaeR
   SERP0364 (saeS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(364454..365419)
Genome map
AA seq 321 aa AA seqDB search
MWFNGHMTLTLAITTMITSCLTLSICSIFINPLIQKIKQFNIKTKQFINHEKFIDDETFQ
SPREIKELNDSFNKMAYEINNQMNMIKNEQQEKTEIIQNLAHDLKTPLAGIRSYSEGLRD
GVISDPQEVHEAYEILIKQANRLSILFDDITHVINLNTGRSYPLELIQLDQLLVNILQPY
EQHIKQENRTLEVNFCTDIDAFYQYRPPIERILTNLLDNALKFSNSGSRIDIIISECKEN
DVISISIKDEGIGIVPELQSRIFERTFRVEDSRNTKTGGSGLGLYIANELAQQIDASITV
QSDLDIGTTMTLTLKKFQFKK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtggtttaatggtcacatgacactcactttagccatcactactatgataacaagctgt
ttaacactttcgatttgtagtatttttattaatcctttaattcagaagattaagcaattc
aatattaagactaagcaatttataaatcacgaaaaattcattgatgatgaaacatttcag
tctcctagagaaattaaagagttgaatgattcttttaataaaatggcatatgaaatcaat
aatcaaatgaatatgataaaaaacgagcaacaagaaaaaactgaaatcatacaaaacctt
gcacatgatttaaaaacacctttagctggtattcgatcatattctgaaggtttacgggat
ggcgtcattagtgatcctcaagaagttcatgaagcatatgaaatattaattaaacaagca
aatcgtttatcaattttatttgatgacattacacatgtgattaatttaaatactggacgt
tcttatcctttggaattaatacagctcgatcaattacttgttaatatattacaaccatac
gaacaacacataaaacaagaaaatcgtacacttgaagttaatttctgcacagatattgat
gcattctaccagtatcgacctccaatcgaacgtattttgaccaatttactagataatgca
ttaaaattttctaattctggtagccgtattgatattattatttctgagtgtaaagaaaac
gacgtcattagtatttcaataaaagatgagggcataggtatcgttccagaacttcaatca
cgtatctttgaaagaacgtttagagttgaagattctcgaaatactaagactggtggttcg
gggttaggattatacattgcaaatgagttagcacaacaaattgacgcctctattacagtc
caaagtgatttagacattggaaccacgatgacacttaccttaaaaaaatttcaatttaaa
aagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system