KEGG   Staphylococcus epidermidis RP62A: SERP0365Help
Entry
SERP0365          CDS       T00229                                 

Gene name
saeR
Definition
DNA-binding response regulator SaeR
Orthology
K10682  
two-component system, OmpR family, response regulator SaeR
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Two-component system
Module
SaeS-SaeR (staphylococcal virulence regulation) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SERP0365 (saeR)
Two-component system [BR:ser02022]
 OmpR family
  SaeS-SaeR [MD:M00468]
   SERP0365 (saeR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(365509..366198)
Genome map
AA seq 229 aa AA seqDB search
MTHLLIVDDEKDIVDICQTYFEYEGYQVTTTTCGKEALKLLSSDIDIMILDIMMPEVSGY
DIVKKMKDMQLDIPFIYLTAKTQEHDTIYALTLGADDYIKKPFSPRELVLRTNNLLARMS
KSNHSNKIEQLEFDGLVLKNLSKTLTINNIEIPMRIKEFELLWYLASREGEVISKSELLE
KVWGYDYYEDANTVNVHIHRIREKLEKHDFLPYTITTVWGLGYKFERSR
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgacccacttactaatcgtggatgatgaaaaagatattgtagacatttgtcaaacgtat
ttcgaatatgaaggatatcaggttacgacaacaacatgtggtaaagaagcactaaaatta
ttatcttcagatatagatattatgattttagacattatgatgccggaagttagcggatac
gatattgtcaaaaaaatgaaagatatgcaacttgatatacctttcatatatctaacagca
aaaactcaagaacatgacacgatatacgcactgacgttaggtgctgatgactatattaaa
aaaccctttagcccaagagaactagtattacgtactaataaccttctcgctagaatgagt
aaatcaaatcattctaataaaattgagcaattagaatttgatggtttagttttaaaaaat
ttaagcaagacacttaccattaacaatatagagatacctatgcgcattaaagaatttgaa
ttgctatggtatcttgcttctagagaaggtgaagttatttctaaatccgaacttctagaa
aaagtatggggatatgactattacgaagatgctaacactgtcaatgtccacatacataga
attcgcgagaaattagaaaaacatgattttttaccctacactattacaactgtgtggggc
cttggttataagtttgaaaggagccgataa

DBGET integrated database retrieval system