KEGG   Staphylococcus epidermidis RP62A: SERP0378Help
Entry
SERP0378          CDS       T00229                                 

Definition
urea amidolyase
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
374374..375378
Genome map
AA seq 334 aa AA seqDB search
MSIIIENSGLFSSFQDFGRKGYEHEGVIPSGALDELAHEIANRLVANDKNEATLEMTQKM
ATIRFTEPALIALTGGNFKAETEHMKIYPNKLYLINEGETLKFNETSRTSRVYLAVGGGF
KLEKWLHSASTDFNVEIGGFEGRKLKKGDEIELKHHYSQRHLKLFENLSDKRTTDWGIDG
YALSFNYVSDVFHVIKNKGTEDFKKEATRRFTTAEYSVSSKTNRVGMVLDGPQIKAYYDD
MPAHQSVKRGTIQVKRDGTPIVLLNDHYTLGSYPQIGTIASYHLTKLAQKPQGSKLKFQF
IDIETAEKNLIKYSNWLNQLFHGIEHRMQLEMLK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatcataattgaaaatagtggcctatttagtagctttcaagattttggaagaaag
ggatatgaacatgaaggtgtcatcccgagtggcgcactagatgaattagcacatgaaata
gccaaccgtctggttgcaaatgacaaaaatgaagcaacacttgaaatgactcaaaaaatg
gcaacaattcgtttcactgagccggcacttatagctttaacaggtggtaattttaaagct
gaaactgaacatatgaaaatttatcctaataaattatatctcatcaatgaaggtgagaca
ttgaaatttaatgaaaccagtcgtacatcacgtgtttatctagcagttggtggaggtttt
aaactagaaaaatggcttcattcagcatctacagattttaatgtggaaattggtggtttt
gagggaagaaagcttaagaaaggtgatgaaatagaattaaaacaccactattctcaacga
catcttaagctatttgaaaacttatctgacaaacgtacaactgattggggaattgatggt
tacgcattgtctttcaattatgtttcggatgtttttcatgttataaaaaataagggaacg
gaagattttaaaaaagaggcgacgcgtcgttttacaacggctgaatatagtgtgtctagt
aaaacaaatagagtaggtatggtgcttgatggcccccaaatcaaagcatactatgatgat
atgccggctcatcaatcagtaaaaagaggaaccattcaagttaagagagatggcacaccg
attgtattattaaacgatcattatacattaggaagttatcctcaaataggtacaatcgca
agctatcatctaacaaaattagcccaaaaaccacaaggctcaaaattgaaatttcaattt
atagatatcgaaactgcagaaaaaaacttaataaagtatagcaattggttaaatcaattg
ttccatggtattgaacaccgtatgcaattagaaatgttaaagtga

DBGET integrated database retrieval system