KEGG   Staphylococcus epidermidis RP62A: SERP0383Help
Entry
SERP0383          CDS       T00229                                 

Definition
ABC transporter ATP-binding protein
Orthology
K15738  
ATP-binding cassette, subfamily F, uup
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
381266..383149
Genome map
AA seq 627 aa AA seqDB search
MEAYKIEHLNKSYADKEIFNDLNLSISEHERIGLVGINGTGKSTLLKVIGGLDEDFTADI
THPNQYRIRYSSQKQDLNGHMTVFEAVLSSDTPTLRIIKKYEEAVNRYALDQSDSNFNKM
MEAQEEMDQKDAWDYNAEIKTILSKLGIHDTTKKIVELSGGQQKRVVLAKTLIEQPDLLL
LDEPTNHLDFESIRWLINYVKQYPHTVLFVTHDRYFLNEVSTRIIELDRGKLKTYPGNYE
DYIVMRAENELVEQKQQEKQKALYKQELAWMRAGAKARTTKQQARINRFNQLESDVKTQH
TQDKGELNLAYSRLGKQVYELKNLSKSINNKVLFEDVTEIIQSGRRIGIVGPNGAGKTTL
LNILSNEDQDYEGELKIGQTVKVAYFKQTEKTLDRDIRVIDYLREESEMAKEKDGTSISV
TQLLERFLFPSATHGKKVYKLSGGEQKRLYLLRLLVHKPNVLLLDEPTNDLDTETLTILE
DYIDDFGGSVITVSHDRYFLNKVVQEYWFIHDGKIEKIIGSFEDYESFKKEHERQAMLSK
QTEQQNKHKHQPKKKTGLSYKEKLEYETIMTRIEMTETRLEDLEQEMINASDNYARIKEL
NEEKEQLEATYEADITRWSELEEIKEQ
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggaagcatacaaaattgaacatttaaataaatcctatgcagataaagaaatttttaat
gatcttaacctatctatatctgagcatgaaagaattggattagtaggtatcaatggaaca
ggtaaaagtacactattaaaagtcattggtggtctagatgaagattttactgcagatatt
acccaccctaatcaatatcgcattcgttattcctctcaaaaacaagacctcaatggccat
atgactgtgttcgaagctgttttaagttcggatactcctacattaagaattataaaaaaa
tatgaagaagcagttaatcgctatgcgttagatcaaagtgactctaattttaataaaatg
atggaagcacaagaagaaatggatcaaaaggatgcatgggactataatgcagaaattaaa
acgattttatctaaactagggattcacgatacaactaagaaaatagttgaactttcgggt
ggtcaacaaaaaagagttgtattggctaaaactctaatagaacaaccggatttacttttg
ctagatgaaccgacgaaccatcttgactttgaatccatccgttggctcattaattatgtc
aagcaatatccacatacagttttatttgtaacacatgatcgctactttttaaatgaagta
tcgacgcgaattattgaactggatagagggaagttaaaaacatatccaggtaattatgaa
gattacatagtaatgcgtgcagaaaatgaattagtagaacaaaaacaacaagaaaaacaa
aaagcattgtataaacaagagttagcatggatgcgagcaggagcaaaggcaagaactact
aaacaacaggcacgtatcaatagatttaatcaactagaatcagacgttaagacgcaacat
acacaagataagggtgaacttaatcttgcatattcaaggttaggtaaacaagtatatgaa
ttaaagaatttatcaaaatcaattaataataaagttttatttgaagatgtcactgaaatt
attcaaagtggtagacgtataggtattgtaggacctaatggagcgggaaaaacaacatta
cttaatattttaagtaatgaagatcaggactatgagggtgagcttaaaatcggtcagact
gttaaggtagcttattttaagcaaacagaaaagacacttgaccgtgatattagagtgatt
gactacctaagagaagaaagtgaaatggctaaagaaaaagatggtacctcaatttcagtt
acacaattgttagaaagatttttatttccgagcgctacacacggtaaaaaagtttataaa
ctctcaggtggagaacaaaaacgtctgtatttattgcgtttacttgttcataaacctaat
gtactccttttagatgaaccgactaatgatttagatactgaaacacttacgattttagaa
gattacattgatgatttcggtggttctgtcattacggtcagtcatgatcgttatttctta
aataaagtggtacaagaatattggtttattcatgatggtaaaatcgaaaaaattattgga
tcatttgaagattatgaatcttttaaaaaggaacatgaacgccaagccatgctatctaaa
caaactgaacaacaaaataaacataagcatcaaccaaaaaagaaaacaggactatcttat
aaagagaagttagaatacgaaacaattatgacgcgtatagaaatgactgaaacgcgttta
gaagaccttgaacaagaaatgattaatgcaagtgataattatgcaagaatcaaagaactt
aatgaggaaaaagagcaacttgaagcaacctatgaagcagacatcacgagatggagtgag
cttgaggaaattaaagaacaataa

DBGET integrated database retrieval system