KEGG   Staphylococcus epidermidis RP62A: SERP0385Help
Entry
SERP0385          CDS       T00229                                 

Definition
ABC transporter ATP-binding protein
Orthology
K05847  
osmoprotectant transport system ATP-binding protein
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ABC transporters
Module
Osmoprotectant transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:ser02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
385141..386115
Genome map
AA seq 324 aa AA seqDB search
MIKFKNVTKRYANNIAVDNVSFNIKEGEFFVLIGPSGCGKTTTLKMINRLIPLSEGYIYF
KDKPISDYPVYEMRWDIGYVLQQIALFPHMTIKENIAQVPQMKKWKDNDIDLRVDELLTM
VGLNPEQFKNRKPDELSGGQRQRVGVVRALAADPPVIIMDEPFSALDPISREKLQDDLIH
LQTQIKKTIVFVTHDIQEAMKLGDRICLLNEGRVEQIDTPDSFRTRPKSDFVKQFMGSHL
DTTHNIVNQVKIKDLGINRSVDDNASVIHYPEVDAELYLNNIYEDLSHYDAVVVNDKEQH
RRYLLNREDVFTYLSLNKEEATHE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtgattaaatttaaaaatgtcacaaagcgatatgctaataatattgctgtagataatgta
agttttaatattaaagaaggagaattttttgtgttaattggtccttcaggttgtggtaag
acaacaacacttaaaatgatcaatcgtttaattcctttaagcgaaggttacatatatttt
aaagataaaccaattagtgattatccagtttacgaaatgcgttgggatattggatatgta
ctacaacaaattgcattatttcctcatatgactatcaaagaaaacattgcacaagtaccc
caaatgaaaaagtggaaagataacgatattgatttacgtgtggatgaattattgacaatg
gtaggtttaaatcctgagcaatttaaaaatagaaaacctgatgaactatcgggtggacaa
cgacaaagggttggtgtagtgcgagcattagctgcagatcctcccgttattatcatggat
gagccttttagtgctcttgacccaattagcagagagaagttgcaggacgatttgattcat
ttgcaaactcaaattaagaaaacaatagtttttgtaacgcatgatattcaagaagcgatg
aaactaggtgacagaatttgtttactcaatgaagggcgtgttgaacaaattgatacacct
gatagttttagaacgcgacctaaaagtgactttgtaaagcaattcatgggtagtcatttg
gatacaacgcataatattgtgaatcaagtgaagattaaagatttaggaattaatcggtct
gtagatgacaatgcaagcgttattcattatcctgaagtagatgctgagttgtacttaaat
aatatttatgaagatttgtctcattatgatgcagttgtggtcaacgataaagaacaacat
cgtcgatatttgttaaatagagaagatgtgtttacttatttatctcttaataaggaggaa
gcgacacatgaatga

DBGET integrated database retrieval system