KEGG   Staphylococcus epidermidis RP62A: SERP0385Help
Entry
SERP0385          CDS       T00229                                 

Definition
(GenBank) ABC transporter, ATP-binding protein
  KO
K05847  osmoprotectant transport system ATP-binding protein
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser02010  ABC transporters
Module
ser_M00209  Osmoprotectant transport system
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SERP0385
Transporters [BR:ser02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Osmoprotectant transporter [MD:M00209]
    SERP0385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_22 AAA_15 AAA_16 SMC_N AAA_29 Rad17 RsgA_GTPase AAA AAA_24 AAA_28 ATPase_2 AAA_30 AAA_5 G-alpha AAA_19 AAA_23 AAA_14
Motif
Other DBs
NCBI-ProteinID: AAW53766
UniProt: Q5HR10
Position
385141..386115
Genome map
AA seq 324 aa AA seqDB search
MIKFKNVTKRYANNIAVDNVSFNIKEGEFFVLIGPSGCGKTTTLKMINRLIPLSEGYIYF
KDKPISDYPVYEMRWDIGYVLQQIALFPHMTIKENIAQVPQMKKWKDNDIDLRVDELLTM
VGLNPEQFKNRKPDELSGGQRQRVGVVRALAADPPVIIMDEPFSALDPISREKLQDDLIH
LQTQIKKTIVFVTHDIQEAMKLGDRICLLNEGRVEQIDTPDSFRTRPKSDFVKQFMGSHL
DTTHNIVNQVKIKDLGINRSVDDNASVIHYPEVDAELYLNNIYEDLSHYDAVVVNDKEQH
RRYLLNREDVFTYLSLNKEEATHE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtgattaaatttaaaaatgtcacaaagcgatatgctaataatattgctgtagataatgta
agttttaatattaaagaaggagaattttttgtgttaattggtccttcaggttgtggtaag
acaacaacacttaaaatgatcaatcgtttaattcctttaagcgaaggttacatatatttt
aaagataaaccaattagtgattatccagtttacgaaatgcgttgggatattggatatgta
ctacaacaaattgcattatttcctcatatgactatcaaagaaaacattgcacaagtaccc
caaatgaaaaagtggaaagataacgatattgatttacgtgtggatgaattattgacaatg
gtaggtttaaatcctgagcaatttaaaaatagaaaacctgatgaactatcgggtggacaa
cgacaaagggttggtgtagtgcgagcattagctgcagatcctcccgttattatcatggat
gagccttttagtgctcttgacccaattagcagagagaagttgcaggacgatttgattcat
ttgcaaactcaaattaagaaaacaatagtttttgtaacgcatgatattcaagaagcgatg
aaactaggtgacagaatttgtttactcaatgaagggcgtgttgaacaaattgatacacct
gatagttttagaacgcgacctaaaagtgactttgtaaagcaattcatgggtagtcatttg
gatacaacgcataatattgtgaatcaagtgaagattaaagatttaggaattaatcggtct
gtagatgacaatgcaagcgttattcattatcctgaagtagatgctgagttgtacttaaat
aatatttatgaagatttgtctcattatgatgcagttgtggtcaacgataaagaacaacat
cgtcgatatttgttaaatagagaagatgtgtttacttatttatctcttaataaggaggaa
gcgacacatgaatga

DBGET integrated database retrieval system