KEGG   Staphylococcus epidermidis RP62A: SERP0400Help
Entry
SERP0400          CDS       T00229                                 

Definition
iron ABC transporter permease
Orthology
K02015  
iron complex transport system permease protein
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ABC transporters
Module
Iron complex transport system
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SERP0400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
401936..402910
Genome map
AA seq 324 aa AA seqDB search
MKFIFKGYTLFILLVILTIVSLFIGVSQLSLIDIFHLSDEQINILFSSRIPRTVSILLSG
SSLALSGLIMQQMMQNKFVSPTTAGTMEWAKLGILMSLLFFPNGPILIKLLFAVVLSIVG
TFLFVQLINLIRVKDVIFVPLLGIMIGGILSSFTTFVALRTNALQSIGNWLTGNFAVITS
GRFEVLYLTIPLLILAFVFANHFTIAGMGKDFSHNLGVSYEKIIKIALFITATLTALVVV
TVGTLPFLGLIVPNIISIYRGDHLKNALPHTLMLGAIFVLIADIIGRIIVYPYEINIGLT
IGVFGTIIFLILLMKGRKNYANER
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttatttttaaaggttataccttatttattttattagtgattttaactattgtc
tctttatttataggggtgagtcagctctctttaatagatattttccatttaagtgatgaa
caaataaacattttgttttcgagtcgaattcccagaacagttagtattctactttcgggt
agttcactagctttatcaggattaattatgcaacagatgatgcaaaataaatttgtaagc
ccaacgactgctggtactatggagtgggcaaaattaggtattttaatgtcattgttgttc
tttcctaatggtcccattttaatcaaattattatttgctgttgttctaagtattgttgga
acgtttttatttgtccaattaattaatcttatccgtgtaaaagatgtaatctttgttcca
cttttaggcattatgattggtggtattttatccagttttactacatttgtagcgttgaga
accaatgctttacaaagcattggaaactggttaactggtaactttgcagttataacgagt
ggtcgttttgaggtgttgtatctcacaataccattacttattttggcatttgtatttgca
aatcattttactattgcaggtatgggaaaagactttagtcataatttaggtgtaagttat
gaaaaaatcattaaaatagcattattcataacagcaacgctaacagcattagttgttgtt
actgttggaacattaccatttttaggtttaatcgtaccgaatatcatatctatctataga
ggcgatcatttgaaaaatgctttaccacacacgcttatgctcggtgcaatttttgtttta
attgctgatattattggtagaataattgtttacccttacgaaattaatattggattgacg
ataggtgtatttggcacaattattttcctaatcttgctaatgaaaggtaggaaaaattat
gcaaatgagcgctaa

DBGET integrated database retrieval system