KEGG   Staphylococcus epidermidis RP62A: SERP0401Help
Entry
SERP0401          CDS       T00229                                 

Definition
iron ABC transporter permease
Orthology
K02015  
iron complex transport system permease protein
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ABC transporters
Module
Iron complex transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:ser02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
402900..403853
Genome map
AA seq 317 aa AA seqDB search
MSANKKISILVVMAICMAIFYLLVGLDFDIFEYQFQSRFKKFILILLVGASIGTSVVIFQ
SITTNRLLTPSIMGLDSVYLFVKVLPIFILGEQATVVTNIYLNFLITLIAMVFFSLLLFQ
VIFKLGHFSVYFILLVGVILGTFFRSITSFLQLIMNPESFLAVQNVMFASFEASNSKLVT
VSGILLVILIIVTIILRPYLDVLLLGRAQAINLGVSYENMTRMFLILVALLVSISTALIG
PVTFLGLLTVNLAHEFMKTYEHKFILPATILFSWISLFIAQWVVENLFEATTEFSLIVDL
VGGSYFIYLLVKRRNAN
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctaataaaaaaataagtatactggtcgttatggcaatttgtatggcaattttt
tatttattggtaggtttagattttgatatatttgaatatcaattccaaagccgtttcaaa
aaatttattcttatattattagtaggagcatcgataggaacgtccgtagttattttccaa
tctattactacaaatagattattaactccttctattatgggacttgattctgtgtattta
tttgtcaaagtcttacctatttttattttaggtgaacaagcaactgttgttacaaatatc
taccttaattttttaatcactttgatcgcaatggtgtttttttcattgctattatttcaa
gttatatttaaactaggtcacttttcagtctatttcatattactagttggtgtaatatta
ggaactttcttccgtagtattacaagttttctccaacttataatgaatcctgaatctttt
ttagcagttcaaaatgttatgtttgctagctttgaagcatcaaattctaaattagtaact
gtttcaggcatattattagttatattaataattgttacaataatacttcgaccatattta
gatgttcttttgttaggtagagcacaagcaattaatctaggtgtttcttatgagaatatg
acgcgtatgtttcttattttggttgctttactcgtctctatatctactgcattaataggt
cctgtaacatttcttggcttattaactgtcaacttagcacacgaatttatgaagacctat
gaacacaaatttattttaccggcaacaatattattcagctggattagtttatttatagcg
caatgggtagttgaaaatctattcgaagcaacaactgaattcagtttgatagtagattta
gttggtggaagttacttcatatatttgcttgtcaaaaggagaaatgcaaattga

DBGET integrated database retrieval system