KEGG   Staphylococcus epidermidis RP62A: SERP0402Help
Entry
SERP0402          CDS       T00229                                 

Definition
iron ABC transporter ATP-binding protein
Orthology
K02013  
iron complex transport system ATP-binding protein [EC:3.6.3.34]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ABC transporters
Module
Iron complex transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:ser02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
403850..404629
Genome map
AA seq 259 aa AA seqDB search
MIQIRNLDKTIDNKPILKDISVDIKKGKLTSLIGPNGAGKSTLLSAISRLFSYENGSILI
EDKEISEYKTDDLAKKLSILKQSNHTDMNITIEQLVKFGRFPYSKGRMKQEDYDKVEYAL
DLLQLNEIKHRNIKTLSGGQRQRAYIAMTIAQDTDYILLDEPLNNLDMKHSVQIMQTLRD
LCRQLNKTIIIVLHDINFASCYSDDIIALKQGELVKADDKDNVIQSDILKSLYEMEVRIE
EIRGQRICLYYDETTFDSV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
ttgattcaaattcgaaatttagataaaacgatagacaataaacctattttaaaagatatt
agcgtagatattaaaaagggaaaattgacttcactcataggtcctaacggtgctggtaag
agtacattattatctgctatcagtcgcttatttagttatgagaacggttcaattttgatt
gaagacaaagaaatttcagaatataaaactgacgatttagctaaaaaattaagtatttta
aaacaatctaatcacactgatatgaacataactatcgagcaactagttaaatttggtcgt
tttccatattcaaaaggtcgaatgaagcaagaagactatgacaaagtggaatatgctctt
gacttattacagcttaatgaaattaaacatcgtaatattaaaacactatctggaggtcag
cgacaacgtgcatatattgctatgactatagcacaagatactgattatatattattagac
gagcctttaaataatttagatatgaaacattcagtacagattatgcaaacgttacgagat
ttatgtcgtcagttaaataaaacaatcattatcgtattacatgatatcaactttgcttct
tgttattcagacgacatcattgcgcttaaacaaggtgagctagttaaagctgatgataaa
gataatgttattcagtctgacattttaaaaagtttatatgaaatggaagtacgtatagag
gagataaggggacaacgtatttgtctatattatgatgaaactacttttgactcagtttaa

DBGET integrated database retrieval system