KEGG   Staphylococcus epidermidis RP62A: SERP0402Help
Entry
SERP0402          CDS       T00229                                 

Definition
iron ABC transporter ATP-binding protein
Orthology
K02013  
iron complex transport system ATP-binding protein [EC:3.6.3.34]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ABC transporters
Module
Iron complex transport system
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SERP0402
Enzymes [BR:ser01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.34  iron-chelate-transporting ATPase
     SERP0402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
403850..404629
Genome map
AA seq 259 aa AA seqDB search
MIQIRNLDKTIDNKPILKDISVDIKKGKLTSLIGPNGAGKSTLLSAISRLFSYENGSILI
EDKEISEYKTDDLAKKLSILKQSNHTDMNITIEQLVKFGRFPYSKGRMKQEDYDKVEYAL
DLLQLNEIKHRNIKTLSGGQRQRAYIAMTIAQDTDYILLDEPLNNLDMKHSVQIMQTLRD
LCRQLNKTIIIVLHDINFASCYSDDIIALKQGELVKADDKDNVIQSDILKSLYEMEVRIE
EIRGQRICLYYDETTFDSV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
ttgattcaaattcgaaatttagataaaacgatagacaataaacctattttaaaagatatt
agcgtagatattaaaaagggaaaattgacttcactcataggtcctaacggtgctggtaag
agtacattattatctgctatcagtcgcttatttagttatgagaacggttcaattttgatt
gaagacaaagaaatttcagaatataaaactgacgatttagctaaaaaattaagtatttta
aaacaatctaatcacactgatatgaacataactatcgagcaactagttaaatttggtcgt
tttccatattcaaaaggtcgaatgaagcaagaagactatgacaaagtggaatatgctctt
gacttattacagcttaatgaaattaaacatcgtaatattaaaacactatctggaggtcag
cgacaacgtgcatatattgctatgactatagcacaagatactgattatatattattagac
gagcctttaaataatttagatatgaaacattcagtacagattatgcaaacgttacgagat
ttatgtcgtcagttaaataaaacaatcattatcgtattacatgatatcaactttgcttct
tgttattcagacgacatcattgcgcttaaacaaggtgagctagttaaagctgatgataaa
gataatgttattcagtctgacattttaaaaagtttatatgaaatggaagtacgtatagag
gagataaggggacaacgtatttgtctatattatgatgaaactacttttgactcagtttaa

DBGET integrated database retrieval system