KEGG   Staphylococcus epidermidis RP62A: SERP0427Help
Entry
SERP0427          CDS       T00229                                 

Gene name
uvrA
Definition
excinuclease ABC subunit A
Orthology
K03701  
excinuclease ABC subunit A
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ser00001]
 Genetic Information Processing
  Replication and repair
   03420 Nucleotide excision repair
    SERP0427 (uvrA)
DNA repair and recombination proteins [BR:ser03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      SERP0427 (uvrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
429809..432643
Genome map
AA seq 944 aa AA seqDB search
MKGPSIVVKGARAHNLKGVDIELPKNKLIVMTGLSGSGKSSLAFDTIYAEGQRRYVESLS
AYARQFLGQMDKPDVDTIEGLSPAISIDQKTTSKNPRSTVATVTEIYDYIRLLYARVGKP
YCPYHGIEIESQTVQQMVDRILELEERTKIQLLAPVISHRKGSHEKLIEDIGKKGYVRLR
VDDEIVDVNEVPQLDKNKNHTIEVVVDRLVVKDGIETRLADSIETALELAEGNLTVDVIN
GEELKFSENHACPICGFSIGELEPRMFSFNSPFGACPTCDGLGQKLKVDLDLVIPDKNKT
LNEGAIEPWEPTSSDFYPTLLKRVCEVYKINMDKPYKKLTDRQKNILMNGSGEKEIEFTF
TQRNGGTRKRKMVFEGVVPNIDRRYHESPSEYTREMMSKYMTELPCETCHGKRLSKEALS
VYVGDYNIGEVVEYSIKNALYYFENLKLSDQDKSIADQILKEIISRLSFLNNVGLEYLTL
DRSSGTLSGGEAQRIRLATQIGSRLTGVLYVLDEPSIGLHQRDNDRLINTLKEMRDLGNT
LIVVEHDDDTMRAADYLVDVGPGAGNHGGEVVSSGTPNKVMKDKKSLTGQYLSGKKRIEV
PEYRREITDRKIQIKGAKSNNLKNVNVDFPLSVLTVVTGVSGSGKSSLVNEILYKALAQK
INKSKVKPGNFDEIKGIDQLDKIIDIDQSPIGRTPRSNPATYTGVFDDIRDVFAQTNEAK
IRGYQKGRFSFNVKGGRCEACKGDGIIKIEMHFLPDVYVPCEVCDGKRYNRETLEVTYKG
KNIADVLEMTVEEATHFFENIPKIKRKLQTLVDVGLGYITLGQQATTLSGGEAQRVKLAS
ELHKRSTGRSIYILDEPTTGLHVDDISRLLKVLNRIVENGDTVVIIEHNLDVIKTADHII
DLGPEGGEGGGTIIATGTPEEIAQNKGSYTGQYLKPVLERDSVE
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaccgtcaattgtagtaaaaggtgcacgagcacataatttaaaaggagtagat
attgaattacctaaaaacaagttgattgtcatgactggactttcaggctcaggtaaatct
tcgttagcgttcgatactatttatgctgaaggtcaacgacgttatgtggaatcgttaagt
gcatatgcgcgacaatttttaggacaaatggacaaacctgatgtagataccattgaaggt
ttgtcaccagcaatatctattgatcagaagacgacaagtaaaaacccacgttctaccgtt
gccactgtgactgaaatctatgattatattcgattattatatgcgcgtgtcggtaaaccg
tactgtccttatcacggtatagaaattgaatcacaaactgttcaacaaatggttgatcgt
attttagaattggaagaacgtacaaaaattcaattacttgctccagttatatcacataga
aaaggaagtcatgaaaaattaattgaagatataggtaagaaaggatatgtgcgtttacgt
gttgatgatgaaatcgtcgatgtaaatgaagtgcctcaattggataaaaataaaaatcac
acaattgaagttgttgttgatagacttgtagttaaagatggcattgagacgcgtttagcg
gactctattgagacagcacttgaacttgctgaaggtaatttaacagttgacgttattaat
ggagaagaacttaaattctctgagaaccacgcatgtcctatatgtggtttctctattggt
gaattagaacctagaatgtttagtttcaacagtccgtttggtgcgtgtccaacttgtgat
ggtttaggtcaaaaactaaaagtagacctagatttagtcattcctgataaaaataaaact
ttaaatgaaggtgcaattgaaccatgggaaccaacaagttcggatttttatccaacttta
ttaaaacgtgtatgtgaagtctacaaaattaatatggataagccatataaaaaattgact
gatagacaaaaaaatatacttatgaatggttctggagaaaaagaaattgaatttactttc
acgcaacgaaatggtggtactcgtaaacgtaaaatggtttttgaaggtgtggtacctaac
attgaccgtcgttaccatgaatctccctctgaatatacacgcgaaatgatgagtaaatat
atgacagagttaccgtgtgaaacttgtcatggcaaacgcttaagcaaagaagcgttatct
gtatacgtaggcgactataatataggtgaagtcgttgaatattcaattaaaaacgcgctt
tattatttcgaaaatttaaaattaagcgaccaagataaatcgattgcagatcaaatttta
aaagagattatttcaagattatcatttttaaataatgttggtttggaatatttgacttta
gatcgctcatcagggactttatctggaggggaagcacaacgtattcgtttagcaacacaa
attggttcacgattaaccggagtactatatgttttagatgaaccttctattggattacat
caaagagataatgatagattaattaatactttaaaagaaatgcgtgatttaggtaataca
cttattgtcgttgaacatgacgatgatactatgagagcagctgattatttagttgatgtg
ggtccgggagctggtaaccacggtggagaggttgtctcaagtggtacccctaataaagta
atgaaagataaaaaatccttaactggtcaatatttaagtggaaaaaaacgaattgaagtc
cctgaatacagacgagaaatcaccgatagaaagattcaaattaaaggtgctaaaagtaat
aatttgaaaaatgtaaatgtagacttcccactatctgtcttaactgttgttacaggtgtg
tcaggttctggtaaaagttcactcgtcaatgaaattttatataaagcattagctcaaaaa
attaataaatctaaagtgaaacctgggaattttgatgaaattaaaggaattgatcaatta
gataaaatcattgatattgatcaatcgccaataggtagaacaccacgttctaacccagcc
acatacactggtgtctttgatgacataagagatgtctttgcacaaacgaatgaagctaaa
atacgaggttatcaaaaaggtagatttagttttaatgtcaaaggtggacgatgtgaagct
tgtaaaggtgatggaattataaaaattgaaatgcattttttaccagatgtctatgtacct
tgtgaagtatgtgatggtaaacgctataatcgtgagactttagaggtaacatacaaaggt
aaaaatattgcggatgtattagaaatgactgttgaagaagctacgcatttctttgaaaat
attcctaagattaaacgtaaattacaaacacttgtagatgttgggttggggtacattact
ttaggtcaacaagctactacattatctggtggcgaagcgcaacgtgtaaaactcgcatca
gaattgcacaaacgttcaacggggcgttctatttatattcttgatgaaccaactacagga
ttacatgtcgacgatataagtcgtttattaaaggtattgaatcgtatagtggaaaatggt
gatacggtcgttattatcgaacacaatcttgatgttattaaaacggctgatcatattatt
gatttaggtccagaaggcggtgaaggtggaggaacaatcatcgcaactggtacacctgaa
gagattgctcaaaataaagggtcttacactggtcaatacttaaaaccagtattagagaga
gacagcgttgaatag

DBGET integrated database retrieval system