KEGG   Staphylococcus epidermidis RP62A: SERP0432Help
Entry
SERP0432          CDS       T00229                                 

Gene name
trxB
Definition
thioredoxin-disulfide reductase (EC:1.8.1.9)
Orthology
K00384  
thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Pyrimidine metabolism
Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SERP0432 (trxB)
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    SERP0432 (trxB)
Enzymes [BR:ser01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     SERP0432 (trxB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
436779..437711
Genome map
AA seq 310 aa AA seqDB search
MTEVDFDVAIIGAGPAGMTAAVYASRANLKTVMIERGMPGGQMANTEEVENFPGFEMITG
PDLSTKMFEHAKKFGAEYQYGDIKSVEDKGDYKVINLGNKEITAHAVIISTGAEYKKIGV
PGEQELGGRGVSYCAVCDGAFFKNKRLFVIGGGDSAVEEGTFLTKFADKVTIVHRRDELR
AQNILQERAFKNDKVDFIWSHTLKTINEKDGKVGSVTLESTKDGAEQTYDADGVFIYIGM
KPLTAPFKNLGITNDAGYIVTQDDMSTKVRGIFAAGDVRDKGLRQIVTATGDGSIAAQSA
ADYITELKDN
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagtagattttgatgtagcaataatcggtgcaggtcctgccggtatgacagca
gcagtatatgcatctcgtgccaatttaaaaactgtcatgattgaacgcggtatgccaggc
ggtcaaatggcaaacactgaagaagtagagaattttccaggatttgagatgatcacaggt
cctgacttatctactaaaatgtttgaacatgctaaaaaatttggtgcggaataccaatat
ggcgatattaaatctgttgaagataaaggcgactataaagttatcaatttagggaataaa
gagataacagcacatgcagttattatctcaactggagcagagtataaaaagattggcgtt
cctggtgaacaagaattaggaggacgtggagtaagttattgtgcggtttgtgatggagca
ttctttaaaaataaacgtcttttcgtaattggcggcggagattcagcggtagaagaaggt
actttcttaactaaatttgcagataaagtaacgattgttcaccgtagagatgaattacgt
gcacaaaacatcttgcaagaacgtgccttcaaaaatgataaagttgactttatttggagt
catacacttaaaacaattaatgaaaaagatggtaaagttggttcagttacacttgaatca
actaaagatggtgctgaacagacttatgatgccgacggtgtattcatttatattggaatg
aaaccactcacagcaccatttaaaaatcttggtattacaaatgacgcgggatacattgtc
acacaagatgacatgagtactaaagtacgaggtatttttgctgcaggtgacgttcgtgat
aaagggttacgtcaaattgttactgctacaggagacggtagtattgcggctcaaagtgca
gctgattatattacagaattaaaagataattaa

DBGET integrated database retrieval system