KEGG   Staphylococcus epidermidis RP62A: SERP0432Help
Entry
SERP0432          CDS       T00229                                 

Gene name
trxB
Definition
thioredoxin-disulfide reductase (EC:1.8.1.9)
Orthology
K00384  
thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Pyrimidine metabolism
Selenocompound metabolism
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ser00240]
Metabolism; Metabolism of other amino acids; Selenocompound metabolism [PATH:ser00450]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
436779..437711
Genome map
AA seq 310 aa AA seqDB search
MTEVDFDVAIIGAGPAGMTAAVYASRANLKTVMIERGMPGGQMANTEEVENFPGFEMITG
PDLSTKMFEHAKKFGAEYQYGDIKSVEDKGDYKVINLGNKEITAHAVIISTGAEYKKIGV
PGEQELGGRGVSYCAVCDGAFFKNKRLFVIGGGDSAVEEGTFLTKFADKVTIVHRRDELR
AQNILQERAFKNDKVDFIWSHTLKTINEKDGKVGSVTLESTKDGAEQTYDADGVFIYIGM
KPLTAPFKNLGITNDAGYIVTQDDMSTKVRGIFAAGDVRDKGLRQIVTATGDGSIAAQSA
ADYITELKDN
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagtagattttgatgtagcaataatcggtgcaggtcctgccggtatgacagca
gcagtatatgcatctcgtgccaatttaaaaactgtcatgattgaacgcggtatgccaggc
ggtcaaatggcaaacactgaagaagtagagaattttccaggatttgagatgatcacaggt
cctgacttatctactaaaatgtttgaacatgctaaaaaatttggtgcggaataccaatat
ggcgatattaaatctgttgaagataaaggcgactataaagttatcaatttagggaataaa
gagataacagcacatgcagttattatctcaactggagcagagtataaaaagattggcgtt
cctggtgaacaagaattaggaggacgtggagtaagttattgtgcggtttgtgatggagca
ttctttaaaaataaacgtcttttcgtaattggcggcggagattcagcggtagaagaaggt
actttcttaactaaatttgcagataaagtaacgattgttcaccgtagagatgaattacgt
gcacaaaacatcttgcaagaacgtgccttcaaaaatgataaagttgactttatttggagt
catacacttaaaacaattaatgaaaaagatggtaaagttggttcagttacacttgaatca
actaaagatggtgctgaacagacttatgatgccgacggtgtattcatttatattggaatg
aaaccactcacagcaccatttaaaaatcttggtattacaaatgacgcgggatacattgtc
acacaagatgacatgagtactaaagtacgaggtatttttgctgcaggtgacgttcgtgat
aaagggttacgtcaaattgttactgctacaggagacggtagtattgcggctcaaagtgca
gctgattatattacagaattaaaagataattaa

DBGET integrated database retrieval system