KEGG   Staphylococcus epidermidis RP62A: SERP0478Help
Entry
SERP0478          CDS       T00229                                 

Definition
(GenBank) IS1272-like transposase, degenerate
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sec23_trunk
Motif
Other DBs
NCBI-ProteinID: AAW53829
UniProt: Q5HQR9
Position
475958..476113
Genome map
AA seq 51 aa AA seqDB search
MYKEYNLTQHTLPMETSVLIPTNDISRHVNDIVETIPDTEFDEFRHHCGLI
NT seq 156 nt NT seq  +upstreamnt  +downstreamnt
atgtataaagaatataacttgactcaacatactctgccaatggaaacttcagttcttatc
cccacaaatgatatttcacgacatgtaaatgatattgtagaaacaattcccgatactgaa
ttcgatgaattcagacatcattgtggcttaatataa

DBGET integrated database retrieval system