KEGG   Staphylococcus epidermidis RP62A: SERP0570Help
Entry
SERP0570          CDS       T00229                                 

Gene name
oppB
Definition
(GenBank) oligopeptide ABC transporter, permease protein
  KO
K15581  
oligopeptide transport system permease protein
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
beta-Lactam resistance
ABC transporters
Module
Oligopeptide transport system
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SERP0570 (oppB)
 Human Diseases
  Antimicrobial resistance
   01501 beta-Lactam resistance
    SERP0570 (oppB)
Transporters [BR:ser02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Oligopeptide transporter [MD:M00439]
    SERP0570 (oppB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
563383..564309
Genome map
AA seq 308 aa AA seqDB search
MTKYVLKRLCYMFVSLFIVITITFFLMKLMPGSPFNDTKLNAQQKEILNEKYGLNDPVAL
QYVNYLKNVVTGDFGNSFQYHNMPVWDLVKPRLIPSMEMGITAMVIGVVLGLVLGVAAAT
KQNTWVDYTTTIISVIAVSVPSFVLAVLLQYVFAVKLEWFPVAGWEGFSTAILPSLALSA
TVLATVARYIRAEMIEVLSSDYILLARAKGNSTLKVLFGHALRNALIPIITIIVPMLAGI
LTGTLTIENIFGVPGLGDQFVRSITTNDFSVIMATTILFSTLFIVSIFIVDILYGVIDPR
IRVQGGKK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgactaaatatgtgttgaaacgattgtgttatatgtttgtgtcgttatttattgttata
acaattacatttttcttaatgaaattaatgccaggatctccgtttaatgacacaaaactt
aatgcgcaacaaaaagaaatattaaatgaaaagtacggtttgaatgatccagtagcatta
caatatgttaattatttgaaaaatgtagtaacaggtgattttggcaactcatttcaatat
cataatatgccagtgtgggatttagttaaaccacgattgataccttcaatggagatggga
ataacagctatggttattggtgttgttttaggtttagtattaggtgttgctgctgctact
aaacaaaatacatgggtagactatacaacaacaattatctctgttatcgcagtatcagtg
ccgtcatttgtcttagcagttttattgcagtatgtatttgcagttaagttagaatggttt
ccagttgcaggatgggaaggtttttctacagctattttaccttctctagcactatcagct
acagttttagcaactgttgcaagatatattagagctgaaatgattgaagtactcagttca
gattacatacttttagctcgagctaaaggaaattctactttaaaagtgctctttggacat
gcattacgaaatgcattaattcctattattacaatcattgtacctatgttagcaggtata
ttaacaggaacattaacaattgaaaatatctttggtgttccaggattaggtgatcaattt
gttcgttctataactacaaatgatttttcagtcatcatggctacaacgatattattcagt
actttatttattgtttcgatctttattgtagacattttatatggtgttatcgatccaaga
attcgtgtacaagggggcaagaaataa

DBGET integrated database retrieval system