KEGG   Staphylococcus epidermidis RP62A: SERP0570Help
Entry
SERP0570          CDS       T00229                                 

Gene name
oppB
Definition
oligopeptide ABC transporter permease
Orthology
K15581  
oligopeptide transport system permease protein
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
beta-Lactam resistance
ABC transporters
Module
Oligopeptide transport system
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SERP0570 (oppB)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SERP0570 (oppB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
563383..564309
Genome map
AA seq 308 aa AA seqDB search
MTKYVLKRLCYMFVSLFIVITITFFLMKLMPGSPFNDTKLNAQQKEILNEKYGLNDPVAL
QYVNYLKNVVTGDFGNSFQYHNMPVWDLVKPRLIPSMEMGITAMVIGVVLGLVLGVAAAT
KQNTWVDYTTTIISVIAVSVPSFVLAVLLQYVFAVKLEWFPVAGWEGFSTAILPSLALSA
TVLATVARYIRAEMIEVLSSDYILLARAKGNSTLKVLFGHALRNALIPIITIIVPMLAGI
LTGTLTIENIFGVPGLGDQFVRSITTNDFSVIMATTILFSTLFIVSIFIVDILYGVIDPR
IRVQGGKK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgactaaatatgtgttgaaacgattgtgttatatgtttgtgtcgttatttattgttata
acaattacatttttcttaatgaaattaatgccaggatctccgtttaatgacacaaaactt
aatgcgcaacaaaaagaaatattaaatgaaaagtacggtttgaatgatccagtagcatta
caatatgttaattatttgaaaaatgtagtaacaggtgattttggcaactcatttcaatat
cataatatgccagtgtgggatttagttaaaccacgattgataccttcaatggagatggga
ataacagctatggttattggtgttgttttaggtttagtattaggtgttgctgctgctact
aaacaaaatacatgggtagactatacaacaacaattatctctgttatcgcagtatcagtg
ccgtcatttgtcttagcagttttattgcagtatgtatttgcagttaagttagaatggttt
ccagttgcaggatgggaaggtttttctacagctattttaccttctctagcactatcagct
acagttttagcaactgttgcaagatatattagagctgaaatgattgaagtactcagttca
gattacatacttttagctcgagctaaaggaaattctactttaaaagtgctctttggacat
gcattacgaaatgcattaattcctattattacaatcattgtacctatgttagcaggtata
ttaacaggaacattaacaattgaaaatatctttggtgttccaggattaggtgatcaattt
gttcgttctataactacaaatgatttttcagtcatcatggctacaacgatattattcagt
actttatttattgtttcgatctttattgtagacattttatatggtgttatcgatccaaga
attcgtgtacaagggggcaagaaataa

DBGET integrated database retrieval system