KEGG   Staphylococcus epidermidis RP62A: SERP0571Help
Entry
SERP0571          CDS       T00229                                 

Gene name
oppC
Definition
(GenBank) oligopeptide ABC transporter, permease protein
  KO
K15582  oligopeptide transport system permease protein
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser01501  beta-Lactam resistance
ser02010  ABC transporters
ser02024  Quorum sensing
Module
ser_M00439  Oligopeptide transport system
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SERP0571 (oppC)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    SERP0571 (oppC)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    SERP0571 (oppC)
Transporters [BR:ser02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Oligopeptide transporter [MD:M00439]
    SERP0571 (oppC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 OppC_N
Motif
Other DBs
NCBI-ProteinID: AAW53965
UniProt: Q5HQH8
Position
564438..565379
Genome map
AA seq 313 aa AA seqDB search
MPRQSKNFWQDAWSQLKRNKLAVIGMIGLLLIVIMAFIGPLMNKHDFAEQNVDHRNLPAK
IPLLDHVSFLPFDGKGTDGKNAYKEAGAKENYWFGTDQLGRDLWTRTWKGAQISLYIGVV
AALLDICIGVVYGAVSGFFGGRVDDVMQRILEIIASIPNLIVVILFVLIFEPSIWTIILA
MSITGWLGMSRVVRGEFLKLKNQEFVLASQTLGASKFKLIFKHILPNTLGAIVVTSMFTV
PSAIFFEAFLSFIGIGVPAPKTSLGSLVNDGRAMLLIHPHELFIPAIILSLLILFFYLFS
DGLRDAFDPKMRK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgccacgtcaaagtaagaatttttggcaagatgcttggtcacaattgaaacgtaataaa
ttagcagtaatcggaatgataggtttgttgcttatagttattatggcatttataggacca
ttaatgaataaacacgattttgctgagcagaatgttgatcatcgtaatctcccagcaaaa
ataccattattagatcatgtttcatttttaccttttgacggtaaaggtacggacggtaaa
aatgcttacaaagaagcaggtgcgaaagaaaactattggtttggtactgatcaacttgga
cgtgatttatggacacgtacttggaaaggtgctcaaatttcactttatattggtgtagtt
gctgcattattagatatttgtattggcgttgtatatggagccgtttctggtttctttgga
ggcagggtagatgatgtgatgcaaaggattttagaaattattgcttctatacccaattta
attgtcgttattttattcgtacttatttttgaaccatcaatttggactattatattagct
atgtcaattactggctggctggggatgagtagagtggtacgtggagaatttttaaaattg
aaaaatcaagaatttgttttggcatctcaaacattgggtgcttctaaattcaagttaatc
tttaaacatatattacctaacacattaggagcaattgtcgttacatcaatgtttactgtt
ccaagtgcaatatttttcgaagcatttttaagctttattggaataggggtgcctgcgcct
aagacgtcattaggatctcttgtcaatgatgggcgtgcaatgttgttgatacatcctcat
gaattatttattccagcaatcattttaagtttattgattttattcttctatctatttagt
gatggactacgtgatgcattcgacccaaaaatgcgaaaataa

DBGET integrated database retrieval system