KEGG   Staphylococcus epidermidis RP62A: SERP0573Help
Entry
SERP0573          CDS       T00229                                 

Gene name
oppF
Definition
oligopeptide ABC transporter ATP-binding protein OppF
Orthology
K10823  
oligopeptide transport system ATP-binding protein
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
beta-Lactam resistance
ABC transporters
Module
Oligopeptide transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:ser02010]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:ser00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
566466..567404
Genome map
AA seq 312 aa AA seqDB search
MSNENVLLQVKNLKQYFNQGKHNEVKAIDNISFDVYKGETLGLVGESGCGKSTTGKAIIK
LNDITDGAIEYDGKDIHQIRKRKERLKFNKKIQMIFQDPYASLNPRLKVMDIVAEGIDIH
KLASSQRDRKKRVYDLLETVGLGKEHANRYPHEFSGGQRQRIGIARALAVEPEFIIADEP
ISALDVSIQAQVVNLLLKLQRERDITLLFIAHDLSMVKYISDRIAVMHFGKIVEIGPADD
IYNYPLHDYTKSLLSAIPQPDPDVERNRQRVLYHEDATLNEERQLNEIRPQHYVFSTQNE
AVKLKQKYGLSV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatgaaaatgtattattacaagttaaaaatttaaaacagtattttaatcaaggt
aaacataatgaagttaaagcgattgataatataagttttgatgtttataaaggggaaact
ttaggcctagtaggagagtctggatgtggtaaatcaacgactggaaaagccattatcaaa
ttaaatgatattactgatggcgcaatcgagtatgatggtaaagatattcatcaaattaga
aaacgtaaagagcgattgaagtttaataagaaaattcaaatgatatttcaagatccttat
gcatctctaaatcctcggttaaaggtaatggatatcgtagctgaaggaatagatattcac
aaacttgctagtagtcagcgtgatcgaaagaaacgtgtatacgaccttttagaaacagtt
ggtttaggtaaagaacacgcgaatcgttacccacatgagttttcaggcggacaaagacaa
cgtattggtatcgcacgtgcattagctgtagagccagaatttattattgcagatgaaccg
atatcagcattagatgtatcgattcaagctcaagtcgttaatcttttattaaagctacaa
cgtgaacgtgatattactttattgtttattgctcatgatttatcaatggtgaaatatatt
tccgatagaattgcagtgatgcacttcggtaaaattgtagaaattggaccggctgatgat
atttataattatccattacatgattatactaagtcattattaagtgccattccacagcct
gatcctgatgttgagagaaatcgtcaacgtgttttatatcatgaagatgcaacgcttaat
gaagaacgtcaattaaatgaaattagaccacaacattatgtattttctactcaaaacgaa
gcagttaaattgaaacaaaagtatggtttgtctgtttaa

DBGET integrated database retrieval system