KEGG   Staphylococcus epidermidis RP62A: SERP0576Help
Entry
SERP0576          CDS       T00229                                 

Definition
(GenBank) glutaredoxin, ArsC family
  KO
K16509  
regulatory protein spx
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
570409..570804
Genome map
AA seq 131 aa AA seqDB search
MVTLFTSPSCTSCRKAKAWLQEHDIPYTERNIFSEHLTIDEIKQILKMTEDGTDEIISTR
SKTYQKLNVDIDSLPLQDLYSIIQDNPGLLRRPIILDDKRLQVGYNEDEIRRFLPRKVRT
FQLQEAQRLVD
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggtaacattatttacttcaccaagttgcacatcttgccgtaaagcgaaagcatggtta
caagaacatgatattccgtatacggagcgtaacattttttctgaacatttaacaattgat
gaaattaaacaaattttaaaaatgactgaagatggaactgacgaaattatttcaacacgt
tctaagacatatcaaaaattgaatgtggatatagattcattaccattacaagatttatac
tcaatcattcaagataatcctggcttgttacgtcgtccaattattttagatgacaaacgt
ttacaagttggatacaacgaagatgaaattcgtcgtttcctaccacgaaaagtacgtacg
ttccaattacaagaagcgcaacgtttagttgattaa

DBGET integrated database retrieval system