KEGG   Staphylococcus epidermidis RP62A: SERP0576Help
Entry
SERP0576          CDS       T00229                                 

Gene name
spxA
Definition
Spx family transcriptional regulator
Orthology
K16509  
regulatory protein spx
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
570409..570804
Genome map
AA seq 131 aa AA seqDB search
MVTLFTSPSCTSCRKAKAWLQEHDIPYTERNIFSEHLTIDEIKQILKMTEDGTDEIISTR
SKTYQKLNVDIDSLPLQDLYSIIQDNPGLLRRPIILDDKRLQVGYNEDEIRRFLPRKVRT
FQLQEAQRLVD
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggtaacattatttacttcaccaagttgcacatcttgccgtaaagcgaaagcatggtta
caagaacatgatattccgtatacggagcgtaacattttttctgaacatttaacaattgat
gaaattaaacaaattttaaaaatgactgaagatggaactgacgaaattatttcaacacgt
tctaagacatatcaaaaattgaatgtggatatagattcattaccattacaagatttatac
tcaatcattcaagataatcctggcttgttacgtcgtccaattattttagatgacaaacgt
ttacaagttggatacaacgaagatgaaattcgtcgtttcctaccacgaaaagtacgtacg
ttccaattacaagaagcgcaacgtttagttgattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system