KEGG   Staphylococcus epidermidis RP62A: SERP0595Help
Entry
SERP0595          CDS       T00229                                 

Definition
daunorubicin resistance protein DrrC
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
588630..590888
Genome map
AA seq 752 aa AA seqDB search
MDFINITGASQNNLKNIDVNIPKHLVTVFTGRSGSGKSSLVFNTVAAESEQLLNESYSSY
IQFHLNQQPRPKVKKIKNLPVAMTINQKRFNGNSRSTVGTVSDIYASVRLLWSRIGEPFV
GYSDAYSFNSPKGMCKTCEGLGYIEDINLDELLDWDKSLNEGAIDFPSFGPDKERGKAYR
DSGLFDNNKKLKDYTKDELELFLYQEPMTLKNPPKEWRKSAKYVGLIPRFSRIFLGDKEF
NKKRYAKHLKNVVNNKICSTCKGQRLNSKILSSKIMSKNISDFTQMTIKENLEFLNKLED
PTAKYIIDPLKKQLEALEYIGLSYLTLNRVTTTLSGGEAQRLKLIRHLNSSLSDLVYIID
EPSVGLHPEDIAKINEILKSLKEKGNTVLIVEHDPDVIKEGDYIIDMGPGSGKNGGEITF
EGTYNELLSSNTSTGNALRNKHNLKENIREANHFYNIGPVTQNNLNNVKTSIPKHVLTVL
TGVAGSGKSTLVKAGFENNDHTIFIDQKAVQGSNRSNLLTYLGVFDSVRSYFSKETGLNK
AMFSYNSKGACPNCGGKGYIKTELAFMGDFSQTCEVCHGKRYKQEVLDATIDGYSIADVL
NLTVDEGIIFFDKKNDIKSKLQSVSKTGLNYMSLGQPLSTLSGGEIQRVKLGQHLDEEIK
NSIFIFDEPTTGLHESDIPILMECFDDLIDQNNTVILIEHNLSIMCEADWIIDVGPGPGL
DGGKVQFSGTPKNFIDSSETLTSKHLKRYIKQ
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atggattttattaatattacaggtgcttcacaaaataacttgaaaaacatagatgtaaat
atcccaaaacacttagtaacggtatttacaggtcgttctggttcagggaaatcatcttta
gtgtttaatactgttgctgcggagtctgaacagctactaaatgaaagttattctagttat
attcaatttcatttaaatcaacaacccagaccgaaagtaaagaaaattaaaaatcttcct
gtagcaatgacgattaatcagaaaagattcaatgggaattctcgctccacggtaggaaca
gtttcagatatatatgcttctgttagattactgtggtctagaataggcgaaccgtttgtt
ggttattcagatgcatattccttcaatagtcctaagggcatgtgtaaaacttgtgaggga
ttaggatatattgaagacattaacttagatgaattgctagattgggataagtctttaaat
gaaggtgcaatagactttccttcttttggaccagacaaagagcgtggtaaagcctatcga
gatagtggtttatttgataataataaaaaattgaaagattatacaaaagatgaattagaa
ttgtttttatatcaagagccaatgacattaaaaaatcctcctaaagaatggagaaagtca
gctaaatatgtaggactaatacctagattcagtagaatatttttaggtgataaagaattt
aataagaaacgctacgccaaacatcttaaaaatgtagtaaataataaaatctgttcaaca
tgtaaaggtcaacgtctaaactcgaaaatattaagttctaaaattatgagtaaaaatatt
tctgatttcacacaaatgacaattaaggaaaatttagagtttcttaataaattagaggat
ccaacagccaaatatattattgatcctctcaaaaagcagttagaagcactagaatatatt
ggattaagttatttaacgcttaaccgtgtcacaacgacattatcaggcggtgaagcgcaa
cggcttaaattaatacgtcatttaaatagttctttatcggatttagtttacattatagat
gaaccaagtgttggcttgcatccggaagatatagctaaaatcaatgaaattttaaaatca
ttaaaagaaaaaggtaatactgtgttaattgttgaacatgatcccgatgtcattaaagaa
ggagactatatcatagatatggggccaggttcaggaaaaaacggcggtgaaatcacattt
gaaggaacatataatgaattactatcttcaaatacttcgacaggtaacgcattacgtaac
aaacataatttaaaagagaatattcgtgaagctaaccacttttataatatcggtcctgtg
acacaaaacaatttaaataacgtaaaaacgtctatacctaaacacgtattaacagtctta
acaggtgttgctggttcaggtaagagtacccttgttaaagcaggttttgaaaataatgac
cataccatctttattgatcaaaaagcagttcaaggatctaatagatctaatctattaacg
tatttaggtgtttttgatagtgtaagaagctatttcagtaaagaaacaggcttaaataaa
gctatgtttagttataattcaaaaggtgcctgtccaaattgtggtggaaagggctatatt
aaaacggaacttgcttttatgggtgatttttcacagacatgtgaagtttgtcatggcaaa
cgttataaacaagaagtattagatgctaccatagacgggtattcaattgccgatgttctc
aatttgacggttgacgaaggtatcattttctttgataaaaagaatgatattaagtcaaaa
ttacaatctgtaagtaagacaggtttgaattatatgtcactaggacaacctttgtccact
ttgtctggtggagagattcaacgcgtgaaactaggacaacatttagatgaagagataaag
aatagtatttttatttttgacgaaccaactacaggcctacatgaatcggatatccctata
ttgatggagtgttttgatgatttaattgatcaaaacaatactgttattttgattgaacat
aatttatcgattatgtgtgaagcagattggatcatcgatgtcggcccaggcccagggttg
gatggcggaaaggtccaatttagtggaacacctaaaaacttcattgatagttcagaaaca
ttgacatctaaacacttgaaacgctatatcaaacagtaa

DBGET integrated database retrieval system