KEGG   Staphylococcus epidermidis RP62A: SERP0609Help
Entry
SERP0609          CDS       T00229                                 

Gene name
prfC
Definition
(GenBank) peptide chain release factor 3
  KO
K02837  peptide chain release factor 3
Organism
ser  Staphylococcus epidermidis RP62A
Brite
Translation factors [BR:ser03012]
 Prokaryotic Type
  Release factors
   SERP0609 (prfC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU RF3_C GTP_EFTU_D2 EFG_II MMR_HSR1 FeoB_N SRPRB
Motif
Other DBs
NCBI-ProteinID: AAW54035
UniProt: Q5HQE4
Position
601848..603410
Genome map
AA seq 520 aa AA seqDB search
MNLKEEIESRKTFAIISHPDAGKTTLTEKLLYFSGAIREAGTVKGKKTGKFATSDWMKVE
QERGISVTSSVMQFDYDDYKINILDTPGHEDFSEDTYRTLMAVDSAVMVIDCAKGIEPQT
LKLFKVCKMRGIPIFTFINKLDRVGKEPFELLDEIEETLNIDTYPMNWPVGMGQNFFGII
DRHSKTIEPFRDEENLLHLNEDYELKEEHAIKNDSAFEQAIEEMMLVDEAGEAFDNEALL
NGELTPVFFGSALANFGVQNFLNAYVDHAPMPNARQTKEEVDVSPFDTDFSGFIFKIQAN
MDPKHRDRIAFMRVVSGAFERGMDVTLQRTNKKQKITRSTSFMADDKETVNHAVAGDIIG
LYDTGNYQIGDTLVGGKQKYSFQELPQFTPEIFMKVSAKNVMKQKHFHKGIEQLVQEGAI
QYYKTLHTNQIILGAVGQLQFEVFEHRMNNEYNVDVVMEPVGRKIARWIENEEDIKDNMN
TSRSILVKDRYDNYVFLFENEFATRWFEEKFSDIKLYSLL
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaaagaagaaatagagtcaagaaagacatttgccatcatttcacaccctgat
gctggtaaaacaactttaactgaaaaattgttgtatttcagtggagcgattcgtgaagct
gggacagttaaagggaaaaagacgggtaaatttgcaacaagtgattggatgaaggtagaa
caagaacgtggtatctcagttacaagctctgtaatgcaatttgattatgatgattataag
ataaatattttagatacgcccgggcatgaagatttttcagaggatacgtatcgtacatta
atggcagtagatagtgcagttatggttattgactgtgcaaaaggtatagaaccacaaaca
ttaaaattatttaaagtttgtaaaatgcgaggtatccctatttttacattcatcaataaa
ttggatagagtaggtaaagagccatttgaattacttgatgaaatagaagaaacacttaat
attgacacttatccaatgaattggcctgttggtatgggacaaaatttctttggtattatt
gatagacactctaaaacgattgaaccatttagagatgaagaaaatttattacatttaaac
gaagattacgaacttaaagaagaacacgcgataaaaaatgatagtgcatttgaacaagca
attgaagaaatgatgcttgtcgatgaagcgggtgaagcatttgataatgaagcgttactg
aacggtgaattaacacctgttttctttggatcggcattagcaaacttcggcgtacaaaat
ttcttaaatgcatacgttgatcatgcgccaatgcctaatgcgagacaaactaaagaagag
gttgatgttagtccattcgacacagatttttctgggtttatctttaaaattcaagccaat
atggatccaaagcatcgtgacagaattgcatttatgcgcgtggtaagtggtgcgtttgaa
agaggaatggatgtaaccttacaaagaactaataaaaaacaaaaaataactcgttccaca
tcatttatggccgatgataaagaaactgttaatcatgctgtagcaggcgatattattggt
ttgtatgatacaggtaactatcaaataggcgatactttagttggtggtaagcagaaatat
agtttccaagagttaccacaatttactccagaaatatttatgaaggtttctgccaaaaat
gtaatgaaacaaaagcattttcataaagggattgaacagcttgttcaagaaggtgcaatt
caatattataaaacgttgcacacaaatcaaattatcttaggtgctgtgggtcaattacaa
tttgaggtgtttgaacaccgcatgaataatgaatataatgtagatgtggttatggaacca
gttggacgtaaaattgcgcgttggattgaaaatgaagaagatattaaagataatatgaat
acttctagatcaattttagtaaaagatagatacgacaattatgtattcctatttgaaaat
gaatttgcaacgcgttggtttgaagaaaaattctctgatattaaactgtatagtttatta
taa

DBGET integrated database retrieval system