KEGG   Staphylococcus epidermidis RP62A: SERP0609Help
Entry
SERP0609          CDS       T00229                                 

Gene name
prfC
Definition
peptide chain release factor 3
Orthology
K02837  
peptide chain release factor 3
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
601848..603410
Genome map
AA seq 520 aa AA seqDB search
MNLKEEIESRKTFAIISHPDAGKTTLTEKLLYFSGAIREAGTVKGKKTGKFATSDWMKVE
QERGISVTSSVMQFDYDDYKINILDTPGHEDFSEDTYRTLMAVDSAVMVIDCAKGIEPQT
LKLFKVCKMRGIPIFTFINKLDRVGKEPFELLDEIEETLNIDTYPMNWPVGMGQNFFGII
DRHSKTIEPFRDEENLLHLNEDYELKEEHAIKNDSAFEQAIEEMMLVDEAGEAFDNEALL
NGELTPVFFGSALANFGVQNFLNAYVDHAPMPNARQTKEEVDVSPFDTDFSGFIFKIQAN
MDPKHRDRIAFMRVVSGAFERGMDVTLQRTNKKQKITRSTSFMADDKETVNHAVAGDIIG
LYDTGNYQIGDTLVGGKQKYSFQELPQFTPEIFMKVSAKNVMKQKHFHKGIEQLVQEGAI
QYYKTLHTNQIILGAVGQLQFEVFEHRMNNEYNVDVVMEPVGRKIARWIENEEDIKDNMN
TSRSILVKDRYDNYVFLFENEFATRWFEEKFSDIKLYSLL
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaaagaagaaatagagtcaagaaagacatttgccatcatttcacaccctgat
gctggtaaaacaactttaactgaaaaattgttgtatttcagtggagcgattcgtgaagct
gggacagttaaagggaaaaagacgggtaaatttgcaacaagtgattggatgaaggtagaa
caagaacgtggtatctcagttacaagctctgtaatgcaatttgattatgatgattataag
ataaatattttagatacgcccgggcatgaagatttttcagaggatacgtatcgtacatta
atggcagtagatagtgcagttatggttattgactgtgcaaaaggtatagaaccacaaaca
ttaaaattatttaaagtttgtaaaatgcgaggtatccctatttttacattcatcaataaa
ttggatagagtaggtaaagagccatttgaattacttgatgaaatagaagaaacacttaat
attgacacttatccaatgaattggcctgttggtatgggacaaaatttctttggtattatt
gatagacactctaaaacgattgaaccatttagagatgaagaaaatttattacatttaaac
gaagattacgaacttaaagaagaacacgcgataaaaaatgatagtgcatttgaacaagca
attgaagaaatgatgcttgtcgatgaagcgggtgaagcatttgataatgaagcgttactg
aacggtgaattaacacctgttttctttggatcggcattagcaaacttcggcgtacaaaat
ttcttaaatgcatacgttgatcatgcgccaatgcctaatgcgagacaaactaaagaagag
gttgatgttagtccattcgacacagatttttctgggtttatctttaaaattcaagccaat
atggatccaaagcatcgtgacagaattgcatttatgcgcgtggtaagtggtgcgtttgaa
agaggaatggatgtaaccttacaaagaactaataaaaaacaaaaaataactcgttccaca
tcatttatggccgatgataaagaaactgttaatcatgctgtagcaggcgatattattggt
ttgtatgatacaggtaactatcaaataggcgatactttagttggtggtaagcagaaatat
agtttccaagagttaccacaatttactccagaaatatttatgaaggtttctgccaaaaat
gtaatgaaacaaaagcattttcataaagggattgaacagcttgttcaagaaggtgcaatt
caatattataaaacgttgcacacaaatcaaattatcttaggtgctgtgggtcaattacaa
tttgaggtgtttgaacaccgcatgaataatgaatataatgtagatgtggttatggaacca
gttggacgtaaaattgcgcgttggattgaaaatgaagaagatattaaagataatatgaat
acttctagatcaattttagtaaaagatagatacgacaattatgtattcctatttgaaaat
gaatttgcaacgcgttggtttgaagaaaaattctctgatattaaactgtatagtttatta
taa

DBGET integrated database retrieval system