KEGG   Staphylococcus epidermidis RP62A: SERP0613Help
Entry
SERP0613          CDS       T00229                                 

Definition
5' nucleotidase
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
608008..609513
Genome map
AA seq 501 aa AA seqDB search
MEKNENKIVDVIATSDMHSHFLNGDYGSNIYRAGTYVNEARKNNENVILLDSGGSLAGSL
AAFYYAVVAPYKRHPMIKLMNAMQYDASGISPNEFKFGLSFLTRSVALSRFPWLSANIEY
TVTREPYFSTPYTIKMYSDLKIAIVGLTSDGLMKNEYAEMEEDVCIEKTLVSAKRWIRYI
HEVEEPDFLIVIYHGGLNKISSANKRNEKNANEAEKIMEELGVIDVIITAHQHQTVVGKD
HGTIYVQAGQNAEELVHLSIKFKKRTTSYEIEHIDSKVIDLNDYHEDEQLLKETYYDRKA
VKHWANSVVSNKNNGLTVQCIEDIICKPHPFTQLLHDAIRLAYNYDISCVHIPKNGEEGL
KGTIRNRDIYDAYPHPDKPIDITVKGKNIKDILEYSYAHIDFNKRQLSMTMIDETLFTVW
QGFDYCIDMSQSPFNRVKLNGLNEEDSYRITMTDYCYRNYKMYLQEAIVHDTYSETMGGL
IRKNLKCDMYSVKLNHNFKVY
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaatgaaaataaaatagttgatgtgattgcaacttctgatatgcatagtcac
ttcttaaatggtgattatggctcaaacatttatcgggctggtacttatgttaatgaagct
cgaaaaaataatgaaaatgtcatattactagatagtgggggaagtttggcgggatcactt
gcagcattttattacgccgttgtagcaccatataaacgtcatcctatgattaagttgatg
aatgcaatgcagtatgatgctagtggaattagccctaatgaatttaaatttggattatct
tttttgacacgttcagttgcactctcaaggtttccttggctatcagcaaatatagagtat
actgttactagagagccatatttttctacgccttatacaatcaaaatgtattcagatttg
aaaattgctatcgtaggtttaacatcagatggattaatgaagaacgagtacgcagaaatg
gaagaagatgtctgtattgagaagactttggtttcagctaaacgttggattagatacata
catgaagttgaagaaccagacttccttattgttatttatcatggtgggttaaataaaatt
agtagtgccaataaaagaaatgaaaaaaatgcaaacgaagctgaaaaaattatggaagaa
cttggtgttattgatgtaattattaccgctcatcaacatcaaacagtagttggaaaagat
catggaactatatatgttcaagcaggtcaaaatgctgaggaattagtacatctttcaatt
aaatttaagaaacgtacaacttcttatgagattgagcacatcgactcaaaagttattgac
ttaaatgattaccatgaagatgagcaattattaaaagaaacatattatgatcgtaaggca
gtcaaacactgggcaaattcagtagtttcaaacaaaaacaatggcttaacagttcaatgt
attgaagatattatttgtaagccgcatccttttactcaattattacatgatgcaattaga
ttagcctataattatgatatttcttgtgtgcatatacctaagaatggtgaggaagggtta
aaaggaactataagaaatagagatatatacgatgcataccctcatccagataaacctata
gatatcactgtcaaaggtaaaaatatcaaagatatacttgaatacagttatgcgcatatt
gattttaataagcgacaattaagtatgacaatgatagatgaaacgttatttacagtttgg
caagggtttgattattgtatagacatgtcacaatcaccgtttaatagagttaaattaaat
ggtctaaatgaagaagattcgtatagaataacaatgacagattattgttatagaaactac
aaaatgtatttacaagaagctatcgttcacgacacatattcggaaacgatgggtggattg
attagaaaaaatttaaaatgtgacatgtattctgtgaaattaaatcataattttaaagtt
tattaa

DBGET integrated database retrieval system