KEGG   Staphylococcus epidermidis RP62A: SERP0638Help
Entry
SERP0638          CDS       T00229                                 

Definition
truncated IS1272 transposase
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(632421..632552)
Genome map
AA seq 43 aa AA seqDB search
MYKDYNKTQLTLPIETSVLIPTNDIHDMYLTHSFFGDELIMNL
NT seq 132 nt NT seq  +upstreamnt  +downstreamnt
atgtataaagattataataagactcaacttactttaccaatagaaacttcagttcttatc
cccacaaatgatattcacgacatgtacctgactcattctttttttggtgatgaactaatt
atgaatttataa

DBGET integrated database retrieval system