KEGG   Staphylococcus epidermidis RP62A: SERP0746Help
Entry
SERP0746          CDS       T00229                                 

Gene name
pbp1
Definition
penicillin-binding protein 1
Orthology
K12552  
penicillin-binding protein 1 [EC:3.4.-.-]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
beta-Lactam resistance
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SERP0746 (pbp1)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SERP0746 (pbp1)
Enzymes [BR:ser01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     SERP0746 (pbp1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
741901..744228
Genome map
AA seq 775 aa AA seqDB search
MAKRKIKIKKNKIGAVLLVGLFGLLFFILVLRFSYIMITGHSNGQDLIMKANEKYLVKNS
QQPERGKIYDRNGKVLAEDVERYKLVAVVDKKASKESKKPRHVVDKKKTAKKLAEIIDMD
ADEIEKRLNNKKAFQIEFGQKGTNLTYQEKEKIEKMKLPGIALYPETERFYPNGNFASHL
IGMAQKDPDTGELNGALGVEKIFNSYLNGSRGALKYIHDIWGYIAPNTKKEQQPKRGDDV
HLTIDSNIQVFVEEALDDMVERYAPKDLFAVVMDAKTGEILAYSQRPTFNPETGKDFGKK
WANDLYQNTYEPGSTFKTYGLAAAIQEGKFKPDEKYKSGQRNIMGSEISDWNKTGWGRIP
MSLGFTYSSNTLMMHLQDLVGADKMKSWYERFGFGKKTGGMFDGEAAGNIGWANELQQKT
SAFGQSTTVTPAQMIQAQSAFFNKGNMLKPWFVSSIDNPITKKNYYSGKKEFAGKPVTQE
TANKVEEELDKVVNSKKSHAMNYRVKGYDIEGKTGTAQVADSNGGGYVKGENPYFVSFMG
DAPKKDPKVIVYAGMSLAQKNDQEAYEMGVSKAFKPIMENTLKYLNVGKSSDTSSKTDYS
KVPNVQGDEVQKAEDSVNAQSLKPITIGNGKQIKQQSVKSGTKVLPHSKVMLMTDGELTM
PDMTGWTKEDVLAFEDLTKIKVSTKGNGFVTNQSISKGQIIKNKDKIEVSLSAEDTDDDQ
EKTDEDSSDKKSKKDKVDEDNSNASSSSKNEKSNADSKNDSDDSTNETSGSERNN
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcgaaaaattaaaattaaaaaaaataaaataggagcagtcctacttgttggt
ttattcggactgctcttttttatattggtgctaaggttttcttatataatgattactggc
cactccaatggtcaagatttaattatgaaagccaatgagaaatatttagtcaaaaattct
caacaaccagaacgaggtaagatttatgatcgtaatggtaaagttttagcagaagatgta
gaaagatataaacttgttgcagttgtggataaaaaagcaagtaaagaaagtaaaaagcct
cgacacgtggttgataaaaaaaagacagcaaaaaaattagctgaaatcatagatatggat
gctgatgaaatagaaaaacgacttaataataagaaagcctttcaaatcgaatttggtcag
aaaggtactaatttaacttatcaagaaaaagaaaaaatagagaaaatgaaattacctggt
atagcactttacccagaaactgagcgcttttatcctaatggtaattttgcttcccattta
atagggatggcacagaaagaccctgatactggtgaattaaatggtgcattaggtgttgaa
aaaatatttaatagttatttaaatggatcaagaggtgcacttaaatatattcatgatata
tggggctacattgcacctaatacgaagaaagagcaacaacctaaacgtggagacgatgta
cacttaacaattgattctaatatccaagtttttgtggaagaagcgcttgatgacatggtt
gaacgttatgctccaaaagatttatttgcagtagtaatggacgcaaaaactggtgaaata
cttgcatatagccaacgtccgacttttaatcctgaaacaggtaaagattttggcaaaaag
tgggcgaacgatttatatcaaaatacatatgaaccgggctctacttttaaaacatacggc
ttagctgcagcaattcaagaaggtaagttcaaaccggatgaaaagtataaatcaggtcaa
agaaatattatgggctctgaaatttccgattggaataaaactggttggggacgtataccc
atgtcgttaggttttacttattcatcaaatacattgatgatgcacttacaagatttggtt
ggtgctgataaaatgaaatcttggtatgaacgctttggatttggcaaaaaaacgggtggt
atgtttgatggagaagctgcaggtaatattggttgggcaaatgaattacaacaaaaaacg
tcagcatttggtcaatcaacaactgttactcctgctcaaatgattcaagcacaatcggca
ttctttaataaaggaaatatgcttaaaccatggtttgtaagtagtatcgataatccaata
actaaaaagaattattactctggtaaaaaagagtttgccggtaaaccagtaacgcaagaa
acagccaataaagttgaagaagaacttgataaagtagtaaatagtaagaagagtcatgcc
atgaattatcgcgtaaaaggttatgatattgaaggtaagacaggaacagcacaagtagct
gattcaaatggaggcggttatgttaaaggtgaaaatccttactttgtaagtttcatgggg
gatgcacctaagaaagatcctaaagtcattgtctatgcaggtatgagtcttgctcaaaaa
aatgatcaagaagcatatgaaatgggtgtgagcaaagcatttaaaccaattatggagaat
acgctgaaatatttaaatgttggaaaatctagtgatacttcatcaaaaactgactatagt
aaagtgcctaacgtgcaaggagatgaagttcaaaaagcagaggatagcgtcaatgctcaa
tctcttaaacctattacgattggtaatggcaaacaaattaaacaacaatcagttaagtca
ggtaccaaagtcctaccgcacagtaaagtaatgttaatgacagacggggaattaacaatg
ccggatatgaccggatggacaaaagaagatgtacttgcttttgaagatttaacgaaaatt
aaagtttctactaaaggtaatggatttgtcacgaatcaaagtatctcaaaaggtcaaatc
attaaaaataaagataagatagaagtatcattatctgctgaagatacggatgatgaccaa
gagaaaactgatgaggactcttcggataaaaaatcaaagaaagataaagttgatgaggat
aattcaaatgcgtcttcatcaagtaagaatgaaaagtcgaacgccgactcgaaaaatgat
tctgatgacagcacaaatgaaacatcaggttctgagagaaataattaa

DBGET integrated database retrieval system